This indicates that the chemical characteristics of all alkali metals are comparable. H 2 2KOH(aq) + 2K(s) + 2H 2 O(l) (g) All group 1 element reactions follow this pattern equation.
Magnesium is oxidised during the formation of magnesium oxide from the reaction of magnesium metal with oxygen. equation. The phrase "reduction" E-'s on the right side of the equation indicate an oxidation process. 2. Review: Redox Reaction Balancing. For instance, F-(aq) + Al3+ = F2(g) + Al(s) (aq) In order to link the amount of Cl2 to the amount using the balanced chemical equation, AlCl3 has a molar mass of 133.33 g/mol, which we must invert to obtain In the area of chemistry known as stoichiometry, relationships between the reactants and/or products of a chemical reaction are used. Reactions in chemicals. 2 H2(g) + O2(g) (g)
To learn more about equation please click on below link
https://brainly.com/question/21620502
#SPJ4
using curved arrow notation, write lewis acid/base equations for each of the following. remember to place formal charge on the appropriate atoms. a. aici3- b. phyp: bf3 bh3
AlCl 3 is Lewis base,PH3 is Lewis base,BH3 is Lewis acid ,BF3 is Lewis acid.
The crucial step is AlCl 3 accepting a chloride ion lone-pair to generate AlCl 4 and the highly acidic, or electrophilic, carbonium ion. Lewis bases: RCl +AlCl 3 → R + + AlCl 4−, etc. [ edit] The highest occupied molecular orbital (HOMO) of an atomic or molecular species that is strongly localised is known as a Lewis base.Lewis acid borane (BH3) has three hydrogen atoms and one boron atom in its molecule. The Lewis structure of borane features a single connection connecting each hydrogen atom to boron (BH3). Only three bonds surround the boron atom, and there are no lone pairs on the atom itself. We will learn how to draw the BH3 Lewis structure in this lesson.Only six electrons orbit the boron atom, according the Lewis structure of BF3. As a result, the boron atom's octal is incomplete. Borane BF3 is therefore regarded as a Lewis acid.A highly poisonous gaseous chemical is phosphorus. Three sigma bonds and one lone pair are present around the phosphorus atom in the Lewis structure of phosphine (PH3). Hydrogen and phosphorous atoms have no charges. The trigonal pyramidal shape of PH3 is a fundamental shape.
learn more about Lewis acid Refer:brainly.com/question/15570523
#SPJ4
a chemistry graduate student is given of a chloroacetic acid solution. chloroacetic acid is a weak acid with . what mass of should the student dissolve in the solution to turn it into a buffer with ph ? you may assume that the volume of the solution doesn't change when the is dissolved in it. be sure your answer has a unit symbol, and round it to significant digits.
Choloracetic acid, 12 g. The colorless solution of the white crystalline substance known as chloroacetic acid.
Up to 80% of the solution can be acidic. By inhalation, ingestion, and skin contact, it is poisonous. It corrodes flesh and metals.
The equilibrium of the buffer is
CH2ClCO2 + H+ HCH2ClCO2
PKA = Log Ka
Ka: [CH2ClCO2] = 1,3 x 103. "H+" / "HCH2ClCO2"
Using the Henderson-Hasselbalch formula:
pH equals pka plus log10 [A]/[HA].
2,89 + log10 [A] / [HA] = 3,01
1,318 = [A⁻] / [HA]
Since chloroacetic acid (HA) has a molar concentration of 0,20M
[A⁻] = 0,26 mol/L
There are 500 mL plus 0.5 L.
Chloroacetic acid is equal to 0,26 mol/L x 0,5 l, or 0,13 moles. By weight:
Choloracetic acid is equal to 0,13 mol (94,5g / 1mol) = 12 g.
Learn more about concentration here-
https://brainly.com/question/10725862
#SPJ4
The density of an unknown element in the gaseous state is 1.60 g at 300 K and 1 atm. Which of the following could be the element?
a. He
b. Ne
c. Ar
d.O2
e. Cl2
Write the overall balanced cell reaction for the following voltaic cell Fe(s) | Fe2+ (aq) || Ag + (aq) | Ag(s) (Ctrl).
the overall balanced cell reaction for the following voltaic cell
Hg2Cl2(s) + Cu(s) ® 2Hg(l) + Cu2+(aq) + 2Cl-(aq)
The cell reaction, also known as the total reaction, is the reaction that occurs within the cell as a whole and is expressed under the assumption that the right electrode is the cathode and that the spontaneous reaction is the one in which reduction takes place in the right-hand compartment.Galvanic, also known as Voltaic, and electrolytic cells are the two varieties of electrochemical cells. While electrolytic cells utilize non-spontaneous reactions and therefore need an external electron source, such as a DC battery or an AC power source, galvanic cells get their energy from spontaneous redox reactions.
Learn more about cell reaction here:
https://brainly.com/question/995105
#SPJ4
Compound A is an alkyne with molecular formula CsH8- When treated with aqueous sulfuric acid and mercuric sulfate, two different products with molecular formula C5H1oo are obtained in equal amounts. 0 Get help answering Molecular Drawing questions. Draw the structure of compound A. Edit 0 Get help answering Molecular Drawing questions. Draw the two products obtained in the box below Edit
Alkynes are hydrocarbons containing a carbon-carbon triple bond. Their general formula is CnH2n-2 for molecules with triple bonds.
Alkynes undergo many of the same reactions as alkenes but can react twice due to the presence of two p-bonds on the triple bond. Ethyne is commonly known by the trivial name acetylene. It is the simplest alkyne, consisting of two carbon atoms joined by a triple bond, where each carbon can bond to a hydrogen atom.
Molecules containing a triple bond between two carbon atoms are called alkynes. A triple bond consists of one σ bond and two π bonds. As for the hydrogen atoms, this compound is unsaturated, so the extra electrons are exchanged with two carbon atoms forming a double bond.
Learn more about An alkyne here:- https://brainly.com/question/6839022
#SPJ4
It is not necessary for velocity measurements to be made in units of concentration per time (M.5-?, for example) in order to calculate Km because the Km is a concentration (the concentration when the velocity equals the velocity divided by two. Question 18 Enzyme A catalyzes the reaction S + P and has a KM of 50 MM and a Vmax of 100 nM.5-1. Enzyme B catalyzes the reaction S → and has a km of 5 mM and a Vmax of 120 nM s 1. When 100 M of S is added to a mixture containing equivalent amounts of enzymes A and B, after 1 minute will be more abundant because . Because is has a much for the two for the substrate than enzymes, the relative efficiency of the enzymes depends almost entirely on their values.
Velocity can be measured using whatever comfortable unit of transition per unit of time. KM is a substrate concentration by meaning (the concentration when vo = Vmax/2), so its valuation doesn't really represent how well the velocity is measured.
The metre per second (m/s) is the basic measure of velocity magnitude (also referred as speed). Alternatively, velocity magnitude could be given in centimetres per second (cm/s). The orientation of a velocity vector can be expressed in different ways, according to the number of variables involved. The Michaelis constant (KM) is defined as the quantity of substrate at which the reaction rate is half of its maximum (or in other words it defines the substrate concentration at which half of the active sites are occupied).
Learn more about substrate concentration here:
https://brainly.com/question/22445180
#SPJ4
cold water can hold more dissolved oxygen than warm water because the solubility of oxygen decreases as temperature increases. T/F
The solubility of oxygen reduces with increasing temperature, hence cold water can store more dissolved oxygen than warm water. The chemical element with the letters O.
And the atomic number 8 is called oxygen. It belongs to the chalcogen group of the periodic table and is a highly reactive nonmetal that rapidly forms oxides with most elements as well as with other compounds. Understanding the makeup of matter developed together with the creation of the concepts of the elements. The substance has been viewed as either continuous or discontinuous at various points throughout history. It is possible to hypothesise that continuous substance is homogenous, infinitely divisible, and has parts that are all the same size.
Learn more about elements here
https://brainly.com/question/11064416
#SPJ4
When some of the sugar added to iced tea remains undissolved at the bottom of the glass, the solution is Most studied answer a) dilute b) unsaturated c) saturated d) polar e) nonpolar
When some of the sugar added to iced tea remains undissolved at the bottom of the glass, the solution is Saturated.
Solution is saturated which means no more solute can be dissolved in the solvent at the given/present temperature and pressure conditions. To dissolve more sugar in the tea we need to increase the temperature of the tea so that the tea becomes unsaturated, for the given conditions also the solubility of the solids increases with the increase in the temperature, so more of the sugar can be dissolved if the temperature of the solvent is increased.
To learn more about Solubility :
brainly.com/question/13372319
#SPJ4
An organism with the genotype of AaXx can produce gametes containing _________ if the two genes are unlinked.
a. either Aa or Xx
b. either AX, Ax, aX, ax
c. AaXx
d. AX or ax
e. None of the above.
An organism with the genotype of AaXx can produce gametes containing either AX, Ax, aX, ax if the two genes are unlinked .
An organism's genotype is the complete set of its genetic material. [1] Genotype can also be used to refer to the alleles or variants that an individual has at a particular gene or locus. The number of alleles an individual can have for a particular gene depends on the number of copies of each chromosome (also called polyploidy) found in that species. Diploid species like humans have two complete sets of chromosomes. This means that each individual has her two alleles for a particular gene. If both alleles are the same, the genotype is said to be homozygous. If the alleles are different, the genotype is called heterozygous.
Genotypes contribute to the phenotype, observable traits and characteristics of an individual or organism. The extent to which genotype influences phenotype depends on the trait.
Learn more about genotype here : https://brainly.com/question/22117
#SPJ4
use the reaction equilibria below to find the k value for the dissociation of the ammonium cation to ammonia and h .
K = [NH3][H+] / [NH4+], The concentrations of the products are not given, the K value cannot be calculated.
What is reaction equilibrium?
Reaction equilibrium is a state of chemical equilibrium in which a chemical reaction and its reverse reaction occur at equal rates. This means that the concentrations of all reactants and products remain constant over time. Equilibrium is reached when the forward and reverse reaction rates are equal and the concentrations of reactants and products are not changing.
NH4+ ⇌ NH3 + H+
The reaction equilibrium constant (K) is equal to the product of the concentrations of the products (NH3 and H+) divided by the concentration of the reactant (NH4+).
K = [NH3][H+] / [NH4+]
Since the concentrations of the products are not given, the K value cannot be calculated.
To learn more about reaction equilibrium
https://brainly.com/question/18849238
#SPJ4
Calculate the amount of heat needed to boil 120.g of acetic acid (HCH3CO2), beginning from a temperature of 16.7°C. Round your answer to 3 significant digits. Also, be sure your answer contains a unit symbol.
The energy required to bring 120 g of acetic acid (HCH3CO2) to a boil at a starting temperature of 16.7 °C is 72.2116 kJ.
Given that ;
mass of acetic acid = 120.0 g
initial temperatureT₁ = 16.7 °C = (16.7 + 273.15 ) K = 298.85 K
standard molar mass of acetic acid = 60.052 g/mol
The number of moles of acetic acid can therefore be calculated as follows: number of moles of acetic acid = mass of acetic acid/molar mass of acetic acid
number of moles of acetic acid = 120.0 g/ 60.052 g/mol
number of moles of acetic acid = 1.998 moles
For acetic acid:
standard boiling point T₂ = 118.1 °C = ( 118.1 + 273.15 ) K = 391.25 K
enthalpy of vaporization of acetic acid ΔH[tex]_{vap}[/tex] = 23.7 kJ/mol
heat capacity of acetic acid c = 2.043 J/g.K
change in temperature Δ T = T₂ - T₁
Δ T = (391.25 - 289.85)K
Δ T = 101.4 K
The heat required to raise the liquid acetic acid's temperature from 16.7°C to its boiling point is;
q = mcΔT
From our values above;
q = 120 g × 2.043 J/g.K × 101.4 K
q = 24859.2 J
q = 24859 /1000 kJ
q = 24.859 kJ
We already determined that we have 1.998 moles of acetic acid;
Thus;
the needed amount of heat = Δ[tex]_{vap}[/tex]*number of moles
The needed amount of heat = 47.3526 kJ
Hence;
The total amount of heat needed = 24.859 kJ + 47.3526 kJ
The total amount of heat needed = 72.2116 kJ
Learn more about acetic acid here:
https://brainly.com/question/24194581
#SPJ4
i can not figure out this question to save my life
Specific heat capacity of a substance is the amount of heat required to raise the temperature by one degree Celsius of one gram of a substance. Therefore, the total enthalpy of the given reaction is -781.44KJ.
What is Enthalpy?Enthalpy term is basically used in thermodynamics to show the overall energy that a matter have. Mathematically, Enthalpy is directly proportional to specific heat capacity of a substances.
Mathematically,
q = n ×ΔH
where
q = amount of heat
n = no of moles
ΔH = enthalpy
n = w / M.M
w = given mass
M.M = molar mass
4CH[tex]_3[/tex]NH[tex]_2[/tex]+2H[tex]_2[/tex]O[tex]\rightarrow[/tex]3CH[tex]_4[/tex]+CO[tex]_2[/tex]+4NH[tex]_3[/tex] ΔH=-138.8KJ
number of moles of methyl amine=175/31.06
=5.63moles
enthalpy for reaction of one mole of methyl amine=-138.8KJ
enthalpy for reaction of 5.63 mole of methyl amine=-138.8KJ×5.63
=-781.44KJ
Therefore, the total enthalpy of the given reaction is -781.44KJ.
To know more about enthalpy, here:
brainly.com/question/24170335
#SPJ1
For how many electrons is the value of ml +2
Only two electrons can be filled in an orbital with a magnetic quantum number (ml) +2.
What are the quantum numbers?The set of numbers that defines the position and energy of the electron filled in a specific orbital are called quantum numbers. Four quantum numbers are principal, azimuthal quantum number, magnetic, and spin quantum numbers.
The principal quantum number (n) denotes the principal electron shell of the atom and the most probable distance between the nucleus and the electrons. The azimuthal quantum number (l) denotes the shape of an orbital in which an electron is present.
The magnetic quantum number denotes the total number of orbitals in a subshell and the orientation of these orbitals. The value of the spin quantum number (s) denotes the direction in which the electron is spinning.
For the value of n = 2, we have five values of ml which are +2, +1, 0, -1, and -2. Every value of ml represents one d-orbital. Each orbital can have two electrons.
Learn more about quantum numbers, here:
brainly.com/question/16977590
#SPJ1
Combustion of 31.68 g of a compound containing only carbon, hydrogen, and oxygen produces 36.67 g CO2 and 15.01 gH2O. What is the empirical formula of the compound?
Combustion of 31.68 g of a compound containing only carbon, hydrogen, and oxygen produces 36.67 g CO₂ and 15.01 g H₂O. the empirical formula of the compound is CH₂O.
given that :
mass of CO₂ = 36.67 g
mass of H₂O = 15.01 g
total mass of compound = 31.68 g
moles of CO₂ = 36.67 / 44
= 0.833 mol
moles of C = 0.833 mol
moles of H₂O = 15.01 / 18
= 0.833 mol
moles of H = 2(0.833)
= 1.667 mol
mass of carbon = 0.833 × 12
= 10 g
mass of hydrogen = 1.667 × 1
= 1.667 g
mass of oxygen = 31.68 - ( 10 + 1.67 )
= 20 g
moles of Oxygen = 20 / 16
= 1.25 mol
dividing by the smallest one :
C = 0.833 / 0.833 = 1
H = 2
O = 1
The empirical formula is CH₂O.
To learn more about empirical formula here
https://brainly.com/question/11288730
#SPJ4
the first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation and have the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin?
The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation. (a) The cleavage sites for the trypsin-catalyzed hydrolysis are, AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK.
(b) The following cleavage sites take place during hydrolysis that is catalyzed by chymotrypsin: AQDDYRYIHFLTQHYCFNMMK. Site-selective breakdown of extremely non-reactive peptide bonds also functions as a therapeutically helpful modulator of protein structure and function, providing essential information on the protein sequence. Regulated and selective cleavage is a challenging task and requires chemical reagents to be able to recognize or bind to one or more specific amino acid residues in the peptide chain. On the basis of this concept, we developed a technique that selectively changes the serine residue in a peptide chain using a chemical reagent, causing the peptide backbone to break at the N-terminus of the serine residue. After cleavage, modified residues can be transformed back into their original form. This method may cleave a wide variety of substrates and does so specifically for certain bioactive peptides with post-translational modifications (like N-acetylation and -methylation) and mutations (like D- and -amino acids), which are known to contribute to age-related diseases.
To know more about cleavage please refer: https://brainly.com/question/9161095
#SPJ4
What is the number of atoms in a mole of any element? (3 points)
Avogadro's number
Graham's number
Its atomic number
Its mass number
Answer:
Avogadro's number
Explanation:
A fresh sample 1311 was left out on the benchtop for 40 days. The scientist forgot it has a half-life of 8 days. The original sample mass
was 64 g. How much of the parent isotope is left?
g
Answer:
2 g of the parent isotope is left.
Explanation:
The half-life of a radioactive isotope is the amount of time it takes for half of the isotope to decay. In this case, the half-life of the isotope is 8 days, which means that after 8 days, half of the isotope will have decayed.
To determine how much of the parent isotope is left after 40 days, we need to calculate how many half-lives have passed in that time. Since the half-life is 8 days, and 40 days have passed, we can divide 40 by 8 to find the number of half-lives that have occurred: 40 / 8 = 5
Since 5 half-lives have passed, we can calculate the amount of the parent isotope that is left by multiplying the original amount of the isotope by 1/2 to the power of the number of half-lives that have passed: 64 * (1/2)^5 = 64 * (1/32) = 2 g
Therefore, after 40 days, only 2 g of the parent isotope is left.
this method of acquiring mw differs from sec and gives dosy nmr many advantages over sec. as stated before, molecules of specific sizes produce indi-vidual diffusion coefficients. due to low sample con-centration, the purity of polymer is not as essential compared to sec; thus, reducing preparation time. dosy also requires minimum amounts of solvent
A well-known NMR technique called diffusion ordered spectroscopy (DOSY) provides diffusion coefficients for specific resonances in NMR spectra.
The main applications of DOSY are the analysis of small molecule mixtures and the oligomeric state of biomolecules. The spreading Self-Diffusion (SD)-NMR and diffusion ordered spectroscopy are two common names for the NMR technology (DOSY). This is accomplished by fusing magnetic field gradients, which encode spatial information, with radio-frequency pulses, which are commonly employed in NMR spectroscopy. Magnetic field gradients are used by Diffusion Ordered Spectroscopy (DOSY) to examine diffusion processes in both solid and liquid materials. Liquid structure is discovered using NMR spectroscopy. It is also used to figure out how soluble chemical molecules are structured.
Learn more about diffusion here-
https://brainly.com/question/10532944
#SPJ4
Correct the volume of 2.90 L of a gas at –12 °C to the volume occupied at 25 °C. Remember to convert between °C and K.
The volume occupied at 25 °C. Remember to convert between °C and K. V2 = 3.311 L is the correct answer.
What is volume?
Volume is the measure of the amount of space occupied by an object or a substance. It is measured in three dimensions: length, width, and height. In the International System of Units (SI), it is measured in cubic meters (m3). Volume is also commonly measured in liters (L), gallons (gal), or cubic feet (ft3). Volume can also refer to the amount of a substance or object, such as the volume of a gas or the volume of a liquid.
Temperature and Volume equation
Given,
The volume at -12°C = 2.90L
Temperature, T1 = -12°C
= (-12°C + 273)
= 261K
And, Volume at 25°C = ?
(25°C + 273)K
= 298K
Now, by using this equation:-
V1/T1 = V2/T2
V2 = V1 x T2/T1
V2 = 2.90L x 298K/261K
V2 = 3.311L
Hence, The volume at 25°C will be 3.311L
To learn more about Temperature and Volume equation
https://brainly.com/question/9956672
#SPJ1
Consider the titration of 100.0 mL of 0.59 M H3A by 0.59 M KOH for the next three questions. The triprotic acid has Ka1 = 1.0 x 10-3, Ka2 = 1.0 x 10-6, and an unknown value for Ka3.1) Calculate the pH after 100.0 mL of KOH has been added.2) Calculate the pH after 150.0 mL of KOH has been added.3) The pH of the solution after 200.0 mL of KOH has been added is 8.00. Determine the value of Ka3 for this triprotic acid. Use scientific notation to enter this answer, e.g., 1.0 x 10-3 = 1.0E-3.
Acid concentration: 0.49 M KOH concentration is 0.49 MKa1=1.0 x 104 eq. rm
a remedy for Take the example of titrating 100 mL of 0.100 M HOCl with 0.100 M KOH at 25 °C. HOCl has a Ka of 3.5 10-8. Calculate the pH after 0.0 mL of KOH in Part 1.
Consider titrating 0.115 M RbOH in a 25.0 mL sample with 0.100 M HCl. Figure out each quantity. The initial pH and the amount of acid that must be added to achieve the equivalence point are also factors. c. the pH after adding 5.0 mL of acid. pH at the equivalency point (d). e. the pH following the addition of 5.0 mL of acid over the equivalency point.
Think about titrating 100 mL of 0.59 M H 3 a 1-3 a2-6 a3. 1) Determine the pH following
To learn more about acid please click on below link
https://brainly.com/question/14072179
#SPJ4
when circuit town electronics sets its televisions at three price levels of $699, $899, and $1,099, it is most likely using .
When circuit town electronics sets its televisions at three price levels of $699, $899, and $1,099, it is most likely using product line pricing.
Product line pricing involves the separation of goods and services into cost categories in order to create various perceived quality levels in the minds of consumers. You might also hear product line pricing referred to as price lining, but they refer to the same practice.Selling a product at or below cost to lure customers in and drive other sales is an example of product-line pricing. A restaurant, for example, might offer a low-priced entrée with the purchase of a drink and dessert that have higher profit margins.A product line refers to a particular good or service that a company makes and markets to customers. A food company may extend a product line by adding various similar or related products (e.g., adding mesquite BBQ flavor to its existing potato chips line), and create a more diversified product family.Using product line pricing allows companies to target customers with low-end, mid-range and high-end budgets. By offering two, three or more product tiers, a company can reach a much larger range of customers. This grants companies the potential to attain more sales and greater brand recognition.
Find more about product line pricing.
brainly.com/question/4910796
#SPJ4
neutrons are useful particles for nuclear bombardment processes because they have charge and are not repelled by a target nucleus. positively charged particles must have sufficient kinetic to overcome repulsion if they are to be used in this way. this is achieved by using a particle .
Neutron is not attracted to the positively charged nucleus since it has no charge. As a result, a neutron can bombard a nucleus even if it is very weak.
As a result, a nuclear reaction can be started by even a very weak neutron bombarding a nucleus. Thus, in a nuclear reaction, a neutron is employed to bombard the nucleus. Neutrons have no charge, therefore they are neither drawn to nor repelled by atoms' nuclei and electrons. Neutron is therefore the best projectile. The connections holding the nucleus together contain enormous energy. These connections can be broken, which will release the nuclear energy. A high-energy neutron is used to start nuclear fission by bombarding a nucleus, which causes the release of further neutrons. The nucleus does not reject a neutron since it has no charge.
To learn more about neutrons click here https://brainly.com/question/29248303
#SPJ4
On a hot afternoon (311 K) a party balloon was filled with 2.07 L of helium. That evening the temperature dropped to 295 K. What is the
new volumen of the balloon?
Answer:
2.02 L
Explanation:
The volume of a gas is directly proportional to its temperature, according to the ideal gas law. This means that as the temperature of a gas decreases, its volume will also decrease.
To determine the new volume of the balloon as the temperature drops from 311 K to 295 K, we can use the ideal gas law to calculate the new volume of the gas:
PV = nRT
Where:
P = the pressure of the gas (assuming it remains constant)
V = the new volume of the gas
n = the number of moles of the gas (assuming it remains constant)
R = the universal gas constant
T = the new temperature of the gas
Since we know the pressure, number of moles, and universal gas constant, we can solve for the new volume of the gas by substituting in the known values and solving for V:
V = nRT / P
Substituting in the values from the problem, we get:
V = (n * R * 295 K) / P
Since the number of moles and the universal gas constant are constants, we can simplify the equation to:
V = k / P
Where k is a constant equal to the product of the number of moles, the universal gas constant, and the original temperature of the gas (in this case, k = n * R * 311 K).
Since we know the value of k and the pressure of the gas, we can solve for the new volume of the gas by substituting in the known values:
V = (k / P)
= (n * R * 311 K) / P
= (2.07 L * 8.31 L * atm / mol * K * 311 K) / P
= 2.02 L
Therefore, the new volume of the balloon is approximately 2.02 L.
The Solubility Of Fe (OH)2 In Water At 25 °C Is Measured To Be 5.2x 10-4 Fe(OH)2 Use This Information To Calculate K Round Your Answer To 2 Significant Digits.
The Solubility Of Fe(OH)₂ In Water At 25 °C Is Measured To Be 5.2x 10⁻⁴ Fe(OH)₂ Ksp value is 5.6 × 10⁻¹⁰.
The chemical reaction is given as follows :
Fe(OH)₂ ⇄ Fe²⁺ + 2OH⁻
Ksp expression for the given reaction is given as follows :
Ksp = [Fe²⁺] [OH⁻]²
the solubilty S = 5.2x 10⁻⁴
so , the Ksp = S × (2S)²
= 4S³
Ksp = 4 ×S³
= 4 × ( 5.2x 10⁻⁴ )³
= 4 × 140.6 × 10⁻¹²
= 5.6 × 10⁻¹⁰
The solubility product value for Fe(OH)₂ that is Ksp value is 5.6 × 10⁻¹⁰.
To learn more about solubility here
https://brainly.com/question/9237932
#SPJ4
Find the volume, in mL, of an object whose density is 400 g/mL and has a mass of 600
mg.
The volume of the object is 1.5ml.
What is the volume of an object?This refers to the space occupied within the boundaries of an object in three-dimensional space. It is also called the capacity of the object.
In the question:
ρ = 400 g/mL
m = 600 mg
v = ?
Formular for calculating density ρ:
ρ = m/v
Where,
ρ= Density of the object
m= Mass of the object
v = volume of the object
Were are given the values of density and mass in the question. We are to calculate the volume.
Makinig v subject of the formular we have:
v = m/ρ
v = 600 mg
400 g/mL
v = 1.5ml
Learn more about volume on
https://brainly.com/question/23937702
#SPJ1
The preparations of two aqueous solutions are described in the table below. For each solution, write the chemical formulas of the major species present at equilibrium. You can leave out water itself Write the chemical formulas of the species that will act as acids in the 'acids' row, the formulas of the species that will act as bases in the 'bases' row, and the formulas of the species that will act as neither acids nor bases in the 'other' row You will find it useful to keep in mind that NH3 is a weak base. acids ,口, 1.3 mol of HNO3 is added to 1.0 L of a 1.3 MNH, solution bases: other acids: bases: - 0.57 mol of KOH is added to 1.0 L of a solution that is 1.2 M in both NH3 and NH4CI. other:
a) NaFi is formed when 1 mol of NaOH is oriented to 1.0 L of a 0.5 M HF mixture.
b) To 1.0 L of a solution that is 0.8 M in both HF & KF-producing KF, 0.3 mol of KOH is added.
An acid generates the hydronium ions H3O+ in an aqueous solution, whereas a base creates the hydroxide ions OH. Water and salt are the byproducts of the neutralization process that occurs when an acid and a base interact.
A) 1 mol of NaOH is counted to 1.0 L of a 0.5 M HF resolution.
The reaction involved in this is:
NaOH + HF → NaF + H2O
acid: HF
base: NaOH
species that neither creates an acid and neither a base nor a salt NaF
b) To 1.0 L of a mixture that seems to be 0.8 M in both HF as well as KF, 0.3 mol of KOH is added.
The reaction involved in this is:
KOH + HF → KF + H2O
acid: HF
base: KOH
the mixture that could be neither an acid nor a base or salt delivered: KF
Learn more about the chemical reaction at
https://brainly.com/question/15357495?referrer=searchResults
#SPJ4
The question is -
The preparations of two aqueous solutions are described below. For each solution, write the chemical formulas of the major species present at equilibrium. You can leave out water itself.
For each of the questions, write the chemical formulas of the species that will act as acids, the formulas of the species that will act as bases, and the formulas of the species that will act as neither acids nor bases. Note that HF is a weak acid.
A) 1 mol of NaOH is added to 1.0 L of a 0.5 M HF solution.
B) 0.3 mol of KOH is added to 1.0 L of a solution that is 0.8 M in both HF and KF.
What is the formula for cobalt (III) oxide?
Co3O2
Co2O3
Co3O
CoO3
Answer:Co2O3
Explanation:
look it up
Answer:
Co2O3
Explanation:
when you write any formula you apply the criss-cross method where you write the charges of each substance
Co3 and O2
applying the criss-cross method( you switch the charges number, in this case you switch the 2 and the 3) :-
Co2 and O3
so Co2O3
Suppose the galvanic cell sketched below is powered by the following reaction: Fe(s)+NiCl2(aq) → FeCl2(aq)+Ni(s) E2 S1 S2 Write a balanced equation for the half-reaction that happens at the cathode of this cell. Write a balanced equation for the half-reaction that happens at the anode of this cell. Of what substance is E1 made? of what substance is E2 made? What are the chemical species in solution S1? What are the chemical species in solution S2?
The chemical species in solution S2 Fe(s)+NiCl2(aq) → FeCl2(aq)+Ni(s)
Fe(s) ------> [tex]Fe^{2+}[/tex] + 2e (Oxidation)
[tex]Ni^{2+}[/tex] (aq) + 2e ------> Ni(s) (Reduction)
Galvanic Cell
Galvanic cells employ the electrical energy generated by the transport of electrons during a redox reaction to carry out practical electrical work. By separating the oxidation and reduction half-reactions and connecting them with a wire so that the electrons must pass through the wire, it is possible to gather the electron flow.
Write a balanced equation for the half-reaction that happens at the cathode of this cell = Ni (aq) + 2e ------> Ni(s)
Write a balanced equation for the half-reaction that happens at the anode of this cell = Fe(s) ------> [tex]Fe^{2+}[/tex] + 2e.
Of what substance is E1 made? = Fe
of what substance is E2 made? = Ni
What are the chemical species in solution S1? = [tex]Fe^{2+}[/tex]
What are the chemical species in solution S2? = [tex]Ni^{2+}[/tex]
To learn more about Galvanic Cell
https://brainly.com/question/15096829
#SPJ1
draw the structure or structures produced by the catalytic reduction of the given compound, in which h2 is in excess.
Structures produced by catalytic reduction of certain compounds where H2 is H2. 1-Ethylcyclohexa-1,4-diene and excess hydrogen-ethyl-2-methylcyclohexane are formed.
Specific compound 1-Ethylcyclohexa-1,4-diene and excess hydrogen-ethyl-2-methylcyclohexane are formed. One compound has the R, S configuration and the other has the S, R configuration. Using the CIP rule, preference is given to groups attached to chiral carbons.
CIP rules are based on the atomic mass of the combined groups, so the group with the highest atomic mass has the lowest number. Since it is a mixture of two enantiomers, it can be called a Rekamic mixture. Selective catalytic reduction refers to the reduction of nitrogen oxides with oxygen and selective inorganic or organic reducing agents.
Learn more about Catalytic reduction here:- https://brainly.com/question/24096820
#SPJ4
part a: identification of a hydrocarbon write out a balanced chemical reaction for 1-hexene with br2 using structural formulae for reactants and products g
The chemical reaction and its components are as follows -
Firstly writing the balanced chemical reaction for 1-hexene and bromine gas -
1-hexene -- [tex] Br_{2}[/tex]/[tex] CH_{3}[/tex]OH--> 1,2-dibromohexane + 1-bromo-2-methoxyhexane
The structural formula of each compound is -
1-hexene: [tex] C_{6}[/tex][tex] H_{12}[/tex]
1,2-dibromohexane: [tex] C_{6}[/tex][tex] H_{12}[/tex][tex] Br_{2}[/tex]
1-bromo-2-methoxyhexane: [tex] C_{7}[/tex][tex] H_{15}[/tex]BrO
Containing alkene group, 1-hexene finds application in Linear Low Density Polyethylene. The products are used in research processes. Reaction involves incorporation of bromine atoms and methyl alcohol group on the hexene.
Learn more about hexene -
https://brainly.com/question/23932163
#SPJ4
