Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer 1

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai


Related Questions

What is the main topic of this report?

community leaders

the hurricane season

government agencies

the Atlantic coast

Answers

the hurricane seasons bc it talks bout it

The main topic of this report is the upcoming hurricane season along the Atlantic coast of the United States and making recommendations for community leaders to prepare and protect their communities based on data from the National Oceanic and Atmospheric Administration, a government agency that studies weather and climate. Thus, option B is correct.

What is the hurricane season?

The hurricane season is a period of time when tropical cyclones, also known as hurricanes, are most likely to form and impact coastal regions.

In the Atlantic basin, which includes the Atlantic Ocean, Caribbean Sea, and Gulf of Mexico, the hurricane season officially runs from June 1 to November 30 each year.

During this time, warm ocean waters and favorable atmospheric conditions create an environment that is conducive to the development of these powerful storms.

Hurricanes can cause devastating damage to homes, businesses, and infrastructure, as well as lead to loss of life. It is important for coastal communities to be prepared for the hurricane season by developing emergency plans, securing homes and property, and staying informed about weather forecasts and evacuation orders.

Learn more about hurricane season here:

https://brainly.com/question/14521255

#SPJ7

Which statement best describe a scientist?

A. A person who only like to ask question
B. A curious person who like to find out answers to question
C. A person who uses a lot of chemicals
D. None of the above

Answers

Answer:

B

Explanation:

because scientist are curious people who find solutions to there curiousness

B a curious person who like to find out answers to question

(1) Many American men were drafted during World War II. (2) Many other men volunteered to serve. (3) In fact, so many men entered the armed services that professional baseball experienced a shortage of good players. (4) Philip K. Wrigley had an interesting solution to the problem. (5) He started a new league. (6) It was called the All-American Girls Professional Baseball League (AAGPBL). (7) To find good players, he scouted women’s softball clubs. (8) They were very popular at that time. (9) The AAGPBL was a hit. (10) In 1948, the year in which the league reached its high point of popularity, more than a million fans came to watch AAGPBL games. (11) The league produced many fine players, including Mary “Bonnie” Baker. (12) Dorothy Kamenshek was also a fine player. (13) After World War II ended, the AAGPBL declined in popularity.
Which is the most effective way to combine sentences 11 and 12?


The league produced many fine players, and they include Mary “Bonnie” Baker and Dorothy Kamenshek.


The league produced many fine players, including Mary “Bonnie” Baker and Dorothy Kamenshek.


The league produced many fine players, Mary “Bonnie” Baker and Dorothy Kamenshek.


The league produced many fine players, Mary “Bonnie” Baker and Dorothy Kamenshek also was fine.

Answers

B - The league produced many fine players, including Mary “Bonnie” Baker and Dorothy Kamenshek.

Explanation:

A has the words "and they include" which has unessesary words when you could just say "including"

B is the shortest accurate statement

C is grammatically incorrect

D doesn't make sense

. During this week, pick a conversation that you wish you could have over again. Who was it with? When was it? What was the topic? Why do you want to do it over? What happened

Answers

Im just making this up :)

Two days ago I had a conversation with my friend about which was better, chocolate or ice cream. I picked the obvious choice, ice cream, and they chose chocolate. I want to re-do this conversation because I stumbled over my words and it embarrassed me! I also realized that some of the points I made were pretty silly, and I would want to use a stronger argument.

Hope this helps!

Write a paragraph for an expository essay following these steps: Choose one of the following topics and limit it: money literature vacations sports Chosen topic: Limited topic: Now, write a single sentence stating your position about your topic. Thesis sentence: Finally, write a three-part analytical thesis about the preceding topic. Three-part analytical thesis: Use the analytical thesis you devised to write several related topic sentences. Using one of the topic sentences you just wrote, write a paragraph developing that idea as fully as possible, making certain that every idea in the paragraph relates back to the thesis and is placed in a logical, effective place within the paragraph. Use transitions to guide your readers.

Answers

Answer:

Lets go with vacations you should write about what you do on holiday where you have been in the past where you are going this year where you hope to go in the future also talk about favourite food and finish with a opinion like if you like it or not

Can any1 help me and find a good theme for this I need help and hopefully it can b well done:)) thank u!!! asap

Answers

Answer:

Wars are common catalysts behind a large disregard for the right of disadvantaged/marginalized groups.

Explanation:

As wars ensues, the idea of the enemy becomes muddled, fueling stereotypes, thus enacting rage against certain groups.

Answer: Wars ( especially civil ) disproportionately affect racial minorities with small or no history of generational wealth.

Explanation:

A great example of this is the American Civil War, where slaves captured by the union army can be held as "enemy contraband" and be forced to work. The reason this happened was because African Americans were seen as "other than human" at the time, because they were racial minority. After the war shifted tides Confederate Soldiers enacted " scorched earth tactics " burning down any infrastructure they could find before the Union Army could take it African Americans had historically lived in very condensed spaces with each other, therefore this seemingly small act disproportionately effected a large community. Free African Americans had a much lower presence in the south than in the North and were much less accepted by the community in which one in every four households owned slaves or 5% of the population. Black people were often victims of racial violence by the confederate army which they could do nothing about.

Can i pass 8th grade with 3 As and 2 clCs and a f in language arts?​

Answers

Try and bring that f up to a passing grade, I recommend dedicating free time to extra studying, maybe even wake up an hour earlier than you usually do for school to be able to study. Also, ask your teacher for extra credit, if she says no, say “so you’re powerless?” This is a psychology trick usually resulting in them responding with no…. and giving you a way to gain credit. It has worked for me so hopefully it can for you

Hope that helps :)

Demographers have added a fifth stage to the classic four-stage transition theory.
Namely, when birth rates fall below replacement and death rates exceed birth rates,
a country can be said to have entered Stage 5. As mentioned in the course, all of
these countries are now considered to be at Stage 5 except
a) Argentina.
b) Greece.
c) Germany.
d) Portugal.

Answers

Answer:  a) Argentina.

The epidemiologic transition describes shifts in population age distributions, mortality, fertility, life expectancy, and death causes, explained further.

What are the four stages of the epidemiological transformation process?

The epidemiologic transition describes shifts in population age distributions, mortality, fertility, life expectancy, and death causes.

Except for Argentina, these countries are now regarded to be in Stage 5.

Learn more about the classic four-stage transition theory here:

https://brainly.com/question/13017356

#SPJ2

Stopping by Woods on a Snowy Evening
by Robert Frost

Whose woods these are I think I know.
His house is in the village, though;
He will not see me stopping here
To watch his woods fill up with snow.

My little horse must think it queer
To stop without a farmhouse near
Between the woods and frozen lake
The darkest evening of the year.

He gives his harness bells a shake
To ask if there is some mistake.
The only other sound's the sweep
Of easy wind and downy flake.

The woods are lovely, dark, and deep.
But I have promises to keep,
And miles to go before I sleep,
And miles to go before I sleep.

What tone does the author establish in this poem?
A.
agitated
B.
anxious
C.
peaceful
D.
fretful

Answers

Answer: The tone that the author establishes in this poem is C. Peaceful ✌️

Hope this helps! =)

Which sentence correctly uses the word compact as a verb?

Carlos chose a compact gift that fit into an envelope.
The two nations formed a compact to increase trade.
William compacts the soda cans so they fit into the recycling container.
Marcus found a broken makeup compact under the park bench.

Answers

Answer: William compacts the soda cans so they fit into the recycling container.

Explanation:

Answer:

i agree with the person above or below

Explanation:

c

Question 22 of 24
What would be the effect of including details from daily life in South America
in a story?
The story would appeal more to readers outside of South America.
B. The story would feel realistic to a South American reader.
C. The story would remind readers of the conflict between religions.
D. The story would have a more somber tone.
O
SUSM

Answers

Answer:

D THE STORY would have a more somber tone

In Romeo and Juliet, Shakespeare explores how difficult it is to escape the circumstances and consequences of your birth. Discuss.
Please help!!!

Answers

Answer and Explanation:

"Romeo and Juliet" written by Shakespeare presents the love story between Romeo and Juliet. Although this is a love story, its ending is not happy and inspiring, but rather tragic, as the two young people cannot be together because of the enmity between their families and end up making very drastic decisions so that they can live the love they feel one for the other.

As members of enemy families, Romeo and Juliet are born with the responsibility to maintain this enmity and prevent any kind of friendly relationship from being established between the families, even if the two have not participated in any activity that established the enmity between their families. When Romeo and Juliet decide to get married, they break this responsibility and reject the circumstances that make them support their family's wishes. However, Shakespeare shows, in his work, that the family obligation is inevitable and fate will find a way to make this responsibility fulfilled. In the play, this happens when Romeo and Juliet die, as proof of their love for each other, which allows their families' wish to be fulfilled, even if in a negative and sad way.

Please Help

What do I say if somebody thinks I don't care about them and why they should care about me even though I do care about them and now they want me to write down why they should care please help this is a serious question don't give me some bs answer that doesn't actually help me like saying "I do care"

Answers

Answer:

Why do you think I don't care about you? I'd do anything to make you happy! Seeing you with a smile is enough to make my day so don't you dare every say something like that again..

Explanation:

Answer:

They shouldn't be questioning you on this and you shouldn't have to explain yourself pero, show them you care by doing what they ask. The little things matter. Write them a paragraph of how much you care for them and what you like most about them. If they are making you write down why they should care you shouldn't waste time on them luv, its not worth it. You know you are worth more. Brag about yourself show them you are better. Tell them how good of a person you are.

4. Romela drinks 2 1/2 L of
water in a day. How many
milliliters of water dow does she
drink all day?

Answers

Answer:

2500 milliliters

Explanation:

Given the following data;

Volume of water = 2½ or 2.5 Litres

To find the volume of water Romela drinks in millimeters;

In this exercise, we would have to convert the volume of water Romela drank (in litres) to its equivalent value in millimeters.

Conversion:

1 liter = 1000 milliliters

2 liters = 2 * 1000 = 2000 milliliters

2.5 liters = 2.5 * 1000 = 2500 milliliters

3 liters = 3 * 1000 = 3000 milliliters

Therefore, the volume of water Romela drank in millimeters is 2500.

As Montag is walking through the woods, he sees a fire. What do you think he means by "It was not burning, it was warming" (Bradbury 139)? What is the significance of this quote in referance to the rest of the novel up to this point?

Answers

Hello. From the background of your question, we can see that you are referring to the book "Fahrenheit 451," which tells the story of a society dominated by an authoritarian government that prohibits the reading of books. In this society, firefighters are responsible for burning books and the houses where those books are found.

Montag, quoted in the question above, is one of those firefighters. However, little by little he starts to get in touch with the books and realizes how empty his life is without reading. In this case, Montag joins a group of people who are fighting to overthrow this government and allow reading to be a legal activity again.

When Montag says the line "It was not burning, it was warming," he is referring to how fire has the ability to bind as well as destroy. That's because he had just run away from a chase, until he found a group of teachers around a campfire. As a firefighter, Montage had only seen the destructive power of fire, but there, he saw how fire plays a role in bringing people together, making them comfortable and allowing a positive and meaningful conversation to be established between people. This quote shows that everything that is destructive can be reframed by people with good knowledge.

Help meeeee SoS help me help me

Answers

Answer:

Wasn't it?

Shouldn't he?

Will he?

Aren't they?

Have you?

Explanation:

Talk about the love story of a couple you know You should say: When and where they first met how their relationship has gone on what you think sbout their story

Answers

Answer:

I'm going to talk about my parents' love story. They met at a church party in the neighborhood where they lived when they were young, and from then on they became friends and then started dating.

Their relationship was marked by distance, as my father was a sailor and traveled the world by ship to do his job, but as he valued their relationship a lot, he decided to look for a steady job in his hometown and so he and my mother were able to get married.

They had two children, some financial difficulties, but with a lot of love and dedication they were able to overcome them and live a simple life but with a lot of companionship.

Select the correct answer from the drop-down menu.
Complete the sentence with the correct explanation.
An author's message
explains the purpose of a story
provides reasons for writing
presents an idea to the reader
clarifies the author's audience

Answers

Answer:

presents an idea to the reader.

Explanation:

An author is the writer of book or an article. An author's message is usually presented before the main book content. The author's message is meant to give the reader an idea of what the story or book is about in a very short yet concise manner. This message is important for reasons including, buyers who really want to know what the content of the book they are about to pick is, they simply cannot read the entire book on the spot, However. with the author's message, they have an idea of what's in the book albeit in summary. Once the author's message is read, an idea of the book's content is understood.

A good test for a suitable thesis statement for your persuasive essay is A. 1) it is an arguable topic, 2) it has outside support, and 3) it asks the reader a question B. 1) it is on a topic no one else has picked, 2) it is relatively short, and 3) it is based on fact C. 1) it is NOT a question, 2) it states your position, and 3) you can put "I believe" in front of it​

Answers

Answer:

A strong thesis statement is key to writing a persuasive essay. The thesis statement presents your topic to the reader, provides your opinion on that topic and summarizes the argument you’ll make in the paper by offering evidence for your opinion. A good thesis statement should capture all of these essential details in just one or two sentences. The thesis statement generally appears after a brief introduction of your topic, often as the last sentence of your first paragraph.

can anyone write romeo and juliet essay 3 short paragraphs?​

Answers

Answer:

Romeo and Juliet’s play is believed to be the sixth most popular play of Shakespeare that has left its mark on millions of hearts. It is for certain that Romeo and Juliet’s play had already been performed by 1597 after the first quarto was published. However, there are no surviving records of Romeo and Juliet play performances before 1660.

It is assumed that Romeo and Juliet most likely had been acted by the Lord Chamberlain’s Men at the Theatre for the first time and soon after at the Curtain as well. But from the records, it can be said for certain that in 1662 Romeo and Juliet was staged by the Duke’s Company.

The plot of Romeo and Juliet has been modified many times over the years. First, William Davenant revived and revised the plot then David Garrick modified several scenes, removing several then considered indecent scenes so that it was considered as the 18th-century version of Romeo and Juliet. Georg Benda used a happy ending and omitted many actions of the play. In this way, the play kept on being modified.

Read the following lines from The Early History of the Airplane.

"It was not till several months had passed, and every phase of the problem had been thrashed over and over, that the various reactions began to untangle themselves."

What words indicate a tone of frustration?

several months, problem, thrashed
thrashed, untangle
every phase, thrashed, reactions
several months, every phase

Answers

Answer:

several months, problem, thrashed

Explanation:

:3< sorry i just gotta say

homestuck!!

Pyramus had left a little later than his Thisbe had, and he could see what surely were the tracks of a wild beast left clearly on deep dust. His face grew ashen. And when he had found the bloodstained shawl, he cried: 'Now this same night will see two lovers lose their lives.' —"Pyramus and Thisbe," Ovid Which statement best describes how the order of events heightens tension in this passage? If Pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion. If the lioness had arrived later, she would have encountered Pyramus rather than Thisbe. If Pyramus had arrived earlier, he would have seen the lion attack Thisbe. If Pyramus and Thisbe had arrived at the same time, they would have encountered the lioness together.

Answers

Answer:

Hello, I believe the answer is if pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion.

Answer:

A is correct

Explanation:

Got it right on edge

do well; do what you tried to do

Answers

yeah what he said yea

In a short story, who do the readers relate to as they read the story

Answers

Answer:

I think it must be the main character, because it is the connection between the characters as well as the context of things

For his science class, Lorenzo is exploring the possible negative impacts of cell phone use on health
Which nonfiction text best matches his reading purpose?
a debate between social media users on the question "Can cell phone use cause cancer?"
O an article published by a nonprofit organization citing how many people currently use cell phones
O a blog that explores why scientists are researching cell phone use and rising cancer rates
O an article from the National Cancer Institute about radiation statistics related to cell phones

Answers

The nonfiction text best matches his reading purpose is an article from the National Cancer Institute about radiation statistics related to cell phones. Thus the correct option is D.

What is a nonfiction Text?

A text or book is said to be "nonfiction" when it is based on real-life events with supporting evidence or facts which help in proving the occurrence of the event.

Any book, piece of entertainment, or other work that honestly aims to inform the readers only about the actual world is considered non-fiction. To educate readers, it ought to be supported by facts and reasoning.

In the given options, an article from the National Cancer Institute about radiation statistics related to cell phones will provide enough evidence and information from a reputed source and will be considered appropriate for the given context.

Therefore, option D is appropriate.

Learn more about  nonfiction text, here:

https://brainly.com/question/1830999

#SPJ2

Pliss you can help me

Answers

a 3
b3
c5
d -2
e 1
f 8
g -2
h 14
l 18

Which sentence is written in the conditional mood?


Why can't you go to the game tonight?


If I can sing well enough, I'll join the school chorus.


You have a tough decision to make.


I didn't meet the requirements, so I can't apply for that scholarship.

Answers

If I can sing well enough, I’ll join the school chorus.
Why? This is because a conditional sentences states “if” something happens

Answer:

i think its the second one

Explanation:

bc it uses "if"

Justice
"That Justice is a blind
goddess
Is a thing to which we
black are wise:
Her bandage hides
two festering sores
That once perhaps
were eyes."
--Langston Hughes
In Langston Hughes's poem "Justice," what is Justice a symbol of?
O A. the justice system that is not biased against race
OB. the justice system that is objective and unflawed
C. the justice system skewed against African Americans
OD. the justice system not caring about human rights

Answers

Answer:

c

Explanation:

this poem tells us 3 times over that the justice system is flawed and in the second verse mentions "we black" so im assuming its african american

Answer:

C.the justice system skewed against African Americans

Explanation:

I took the test and made a 100%

Here are some pieces of advice that Randy Pausch gave in his speech "The Last Lecture." Which suggestions would you be most likely to follow? Check any that apply.

Answers

Answer:

Show gratitude

Work harder

Be good at something

Explanation:

"The Last Lecture" was a famous book that was published in the year 2008. It was been co-authored by the writer and professor, Randy Pausch. The book was mainly written to provide an insight and energized people to affirm the life by relentlessly by pursuing their dreams. He realizes that achievement is the ultimate end of life.

Thus from Randy Pausch book, we ac most likely to follow the following :

Show gratitude

Work harder

Be good at something

what do you understand about the song "True colors"?

Would you recommend the song to your friends? why?​

Answers

Answer:

It's about showing who you really are.

Explanation:

to reveal one's real nature or character

Answer:

it’s okay to be different

Explanation:

This song is about showing people who you really are and showing your "true colours", in other words, your true self! When I think of this song, I think about bullying.People get bullied because they're "different".This song shows that it's ok to be different and to be yourself!Someone will love you the way you are! Don't be afraid of what others will think of you and be yourself!

Other Questions
How many families in Oats Township have two or more cars?100412400200 Which statement best describes how Shackleton feels when the ice floe on which he has made camp cracks into two pieces? A. He is terrified by the danger he and the others are now facing. B. He is saddened by the loss of a shelter that has grown familiar. D. He is thrilled by the prospect of encountering new adventures. E. He is glad that the long, tiresome wait on the ice floe has ended. What is Bt Cotton. Explain its mode of action. George has a spinner with three equal sections colored orange, blue, and white. He spins the spinner 100 times. What is the experimental probability of landing on the orange section? The bakery manager at the grocery store decides to have a 18% off sale on all bread. You decide to purchase 3 loaves of bread. Let b be the original price of a loaf of bread. Expand the expression 3(b 0.18b). What do the terms of the expansion represent? Your broker suggests that the stock of DUH is a good purchase at $25. You do an analysis of the firm, determining that the recent $1.40 dividend and earnings should continue to grow indefinitely at 5 percent annually. The firm's beta coefficient is 1.3, and the yield on Treasury bills is 1.4 percent. If you expect the market to earn a return of 8 percent, what is your valuation of DUH A hot air balloon has an air vent that keeps the air pressure inside and outside the same. Allen observes that a hot air balloon rises up when the gas molecules inside it are heated. Whichof the following laws is used to understand the behavior of the gas and why?a) The high temperature brings the gas molecules closer together according to Charles's law because this law describes how a gas will behave at constant pressureb) The high temperature makes the gas molecules spread apart according to Charles's law because this law describes how a gas will behave at constant pressure.c) The high temperature lowers volume according to Boyle's law because this law describes how a gas will behave when the number of moles remains constant.d) The high temperature ralses volume according to Boyle's law because this law describes how a gas will behave when the number of moles remains constant. Write a brief summary of the story in one or two sentences of the tell tale heart Analyze the diagram below and complete the instructions that follow.Find the exact value of tan(M). Find the difference. 7.6 - 5.88 What is the inverse of the function g(x) = 1/2x + 1/2? The hire purchase price of a fridge is 16400. 25% is paid as deposit, the rest is spread over 12 equally monthly instalments. If the cash price is 20% less the hire purchase pries, (a) find the costs price of the fridge (b) calculate the deposit (c) what is the monthly installments (d) what is the differences between the cash price and the hire purchase prie This political cartoon is from 1919:An image shows a worker bound and gagged, lying on an anvil that is labeled capital. In front of the man stands an armored man labeled Knights of Labor. The armored man holds a hammer above the worker that reads Strike. The caption reads, Between the hammer and the anvil. The Granger Collection/Image Quest 2012Based on the cartoon, which of the following conclusions can be drawn? Union leaders worked to increase benefits for the common worker using two means: violence and illegal tactics. Workers strongly believed that striking was the only method that would cause government leaders to change unfair working conditions. Workers were had two unfavorable conditions: government regulation of business and the dangers of unions. Union leaders did little to help individual workers and instead took strides to benefit only themselves and their government supporters. What is the surface area and volume of the sphere shown below?Your response should show all necessary calculations and diagrams. In which artistic style is this painting, The Artist's Garden atGivernyImpressionistromanticabstractcubist examples of intuitionism theory in health care please help with this !!!! SO you hopefully selected that an Allele is a form of a gene. BUT what is this really...A. an allele is a protein that causes hair no hair in the guinea pigB. an allele is a length of DNA with a specific sequence of nitrogen bases that make a protein that results in Hair or No Hair on the guinea pig PLS HELP ASAP! FIND THE VOLUME OF X. 20. What is an irreversible change?