For the reaction shown, find the limiting reactant for
each of the following initial amounts of reactants.
2 Al (s) + 3 Br2 (g) → 2 AlBr3 (s)
1.0g AL; 1.0g Br2

Structures produced by catalytic reduction of certain compounds where H2 is H2. 1-Ethylcyclohexa-1,4-diene and excess hydrogen-ethyl-2-methylcyclohexane are formed.

Specific compound 1-Ethylcyclohexa-1,4-diene and excess hydrogen-ethyl-2-methylcyclohexane are formed. One compound has the R, S configuration and the other has the S, R configuration. Using the CIP rule, preference is given to groups attached to chiral carbons.

CIP rules are based on the atomic mass of the combined groups, so the group with the highest atomic mass has the lowest number. Since it is a mixture of two enantiomers, it can be called a Rekamic mixture. Selective catalytic reduction refers to the reduction of nitrogen oxides with oxygen and selective inorganic or organic reducing agents.

Learn more about Catalytic reduction here:- https://brainly.com/question/24096820

#SPJ4

The volume occupied at 25 °C. Remember to convert between °C and K. V2 = 3.311 L is the correct answer.

What is volume?

Volume is the measure of the amount of space occupied by an object or a substance. It is measured in three dimensions: length, width, and height. In the International System of Units (SI), it is measured in cubic meters (m3). Volume is also commonly measured in liters (L), gallons (gal), or cubic feet (ft3). Volume can also refer to the amount of a substance or object, such as the volume of a gas or the volume of a liquid.

Temperature and Volume equation

Given,

The volume at -12°C = 2.90L

Temperature, T1 = -12°C

= (-12°C + 273)

= 261K

And, Volume at 25°C = ?

(25°C + 273)K

= 298K

Now, by using this equation:-

V1/T1 = V2/T2

V2 = V1 x T2/T1

V2 = 2.90L x 298K/261K

V2 = 3.311L

Hence, The volume at  25°C will be 3.311L

To learn more about Temperature and Volume equation

https://brainly.com/question/9956672

#SPJ1

When atoms or groups project on either the same or opposite sides of a reference plane that is common to stereoisomers, they are referred to as being cis or trans to one another.

Cis/trans isomers are the substances in which such relationships exist. The reference plane for doubly bonded atoms is perpendicular to the plane holding the doubly bonded atoms and the atoms that are directly connected to them. It also contains these atoms. The reference plane for cyclic compounds is the plane in which the ring skeleton is located or comes close to being located. The steric relations of the substituents are stated by adding when one substituent and one hydrogen atom are connected at each of a monocycle's more than two locations.

Learn more about isomers here-

https://brainly.com/question/12796779

#SPJ4

1 A + two C and d → C + S t where rate=k[A][B][rate] 2. An experiment with [A]o = 0.000847 T s as well as [B]o = 1.11 M was run for a predefined number of seconds. The slope of a ln[A] vs. grown steadily was -9.43. rate of reaction is 3.62m/s

Slope and slant both refer to an incline up from a reference surface or line that is generally straight. The ground slopes (either upward or straight down) sharply here. To slope is to slope vertically in an ambiguous path A line's steepness could be determined by looking at its slope. Altitude is calculated mathematically as "rise over run."

Learn more about reaction here:

https://brainly.com/question/13440548

#SPJ4

As per law of conservation of energy, energy  can be converted from one form to another, renewable sources of energy best meets needs of society as they are everlasting and can be renewed from fossil fuels.

According to law of conservation of energy, it is evident that energy is neither created nor destroyed rather it is restored at the end of a chemical reaction .

Renewable sources of energy are extensively being used as they long lasting and provide less carbon footprints.Every source of energy obeys law of conservation of energy by it getting transformed into another.

Learn more about law of conservation of energy,here:

https://brainly.com/question/29775341

#SPJ1

The initial amount of 14C in the 3700-year-old wooden object is 9.81 decay events per minute per gram of carbon.

Half-life is a term used in radioactive decay to describe the time it takes for half of the radioactive atoms in a substance to undergo decay or transform into another element or isotope. It is a characteristic property of a radioactive material, and during each half-life period, the amount of the radioactive substance decreases by half.

The initial amount of 14C (N₀) can be calculated using the decay formula:

N₀ = N × exp(-λ × t)

where:

N₀ is the initial amount of 14C (in disintegrations per minute per gram of carbon).

N is the equilibrium concentration of 14C (15.3 decay events per minute per gram of carbon).

λ is the decay constant (ln(2) / half-life of 14C).

Given that the half-life of 14C is t1/2 = 5715 years

λ = ln(2) / t1/2

λ = ln(2) / 5715 yr

= 0.0001210155 yr⁻¹

N₀ = 15.3 events/min/g × exp(-0.0001210155 yr⁻¹ × 3700 yr)

N₀ = 15.3 events/min/g × exp(-0.4480609)

N₀ = 15.3 events/min/g × 0.6402964

N₀ = 9.81 events/min/g

Learn more about Half life, here:

https://brainly.com/question/31666695

#SPJ12

Only two electrons can be filled in an orbital with a magnetic quantum number (ml) +2.

The set of numbers that defines the position and energy of the electron filled in a specific orbital are called quantum numbers. Four quantum numbers are principal, azimuthal quantum number, magnetic, and spin quantum numbers.

The principal quantum number (n) denotes the principal electron shell of the atom and the most probable distance between the nucleus and the electrons. The azimuthal quantum number (l) denotes the shape of an orbital in which an electron is present.

The magnetic quantum number denotes the total number of orbitals in a subshell and the orientation of these orbitals.  The value of the spin quantum number (s) denotes the direction in which the electron is spinning.

For the value of n = 2, we have five values of ml which are +2, +1, 0, -1, and -2. Every value of ml represents one d-orbital. Each orbital can have two electrons.

Learn more about quantum numbers, here:

brainly.com/question/16977590

#SPJ1

The chemical reaction and its components are as follows -

Firstly writing the balanced chemical reaction for 1-hexene and bromine gas -

1-hexene -- [tex] Br_{2}[/tex]/[tex] CH_{3}[/tex]OH--> 1,2-dibromohexane + 1-bromo-2-methoxyhexane

The structural formula of each compound is -

1-hexene: [tex] C_{6}[/tex][tex] H_{12}[/tex]

1,2-dibromohexane: [tex] C_{6}[/tex][tex] H_{12}[/tex][tex] Br_{2}[/tex]

1-bromo-2-methoxyhexane: [tex] C_{7}[/tex][tex] H_{15}[/tex]BrO

Containing alkene group, 1-hexene finds application in Linear Low Density Polyethylene. The products are used in research processes. Reaction involves incorporation of bromine atoms and methyl alcohol group on the hexene.

Learn more about hexene -

https://brainly.com/question/23932163

#SPJ4

The statements that are true about the organization of the periodic table are as follows:

Periodic table is a tabular chart of the chemical elements according to their atomic numbers so that elements with similar properties are in the same group (column).

The periodic table of chemical elements, often called the periodic table, organizes all discovered chemical elements in rows (called periods) and columns (called groups) according to increasing atomic number.

This suggests that options B and D are correct regarding the arrangement of elements in the periodic table.

Learn more about periodic table at: https://brainly.com/question/11155928

#SPJ1

Benzaldehyde substrates using the transient directing group strategy. Without installing any auxiliary directing group, Pd(II)-catalyzed C–H arylation, chlorination, bromination, and Ir(III)-catalyzed amidation, could be achieved on benzaldehyde substrates.

The only Pd-catalyzed C-H functionalizations favored by ephemeral directing groups continue to be C-H arylation. Here, we present a broad range of ortho-C(sp2)-H functionalizations of benzaldehyde substrates that were achieved by employing a transient directing group technique. Pd(II)-catalyzed C-H arylation, chlorination, bromination, and Ir(III)-catalyzed amidation could all be accomplished on benzaldehyde substrates without the use of an auxiliary directing group. The potential for metal-catalyzed C-H functionalization of benzaldehydes is greatly increased by the temporary directing groups produced in situ by imine linkage that can override other coordinating functional groups that can direct C-H activation or catalyst poisoning. Numerous uses of this strategy, such as the late-stage diversification of a pharmacological counterpart, show its usefulness. A benzene ring with a formyl substituent makes up the chemical molecule known as benzoaldehyde (C6H5CHO). The simplest aromatic aldehyde is this one.

Learn more about Benzaldehyde here:

https://brainly.com/question/28146845

#SPJ4

if a mole of argon gas is warmed to 700 k as well as its pressure is reduced to 0.0800 bar, then measure the change in entropy. Suppose that the ideal gas behaviour is 38.61 J/K.

Entropy, broad sense, serves as a metric for energy quality, with lower entropy indicating better quality. Entropy is lower for energy that's been carefully arranged (the efficient library). The random-pile library is a chaotic energy storage device with high entropy. All parts of our daily life are impacted by entropy, which would be merely a measure of disorder. In actuality, it may be considered humanity's greatest tax. Dysfunction spreads over time if left unchecked. Systems collapse into chaos when energy diffuses. Something is much more chaotic the more

Learn more about entropy here:

https://brainly.com/question/13146879

#SPJ4

Answer:

2 g of the parent isotope is left.

Explanation:

The half-life of a radioactive isotope is the amount of time it takes for half of the isotope to decay. In this case, the half-life of the isotope is 8 days, which means that after 8 days, half of the isotope will have decayed.

To determine how much of the parent isotope is left after 40 days, we need to calculate how many half-lives have passed in that time. Since the half-life is 8 days, and 40 days have passed, we can divide 40 by 8 to find the number of half-lives that have occurred: 40 / 8 = 5

Since 5 half-lives have passed, we can calculate the amount of the parent isotope that is left by multiplying the original amount of the isotope by 1/2 to the power of the number of half-lives that have passed: 64 * (1/2)^5 = 64 * (1/32) = 2 g

Therefore, after 40 days, only 2 g of the parent isotope is left.

onclude about the trends in the solubilities of the compounds of the alkaline earth metals

The solubility or, as we can say, the activity of the chemical, increases as one moves down the group. Since barium is more active

Chemical element barium (Ba), an alkaline-earth metal belonging to Group 2 (IIa) of the periodic chart. The substance is utilized in metallurgy, and pyrotechnics, petroleum production, and radiology all make use of its constituents.What is the purpose of barium?

Barium is solely utilized for GI tract imaging tests. An upper GI series may include a barium swallow test in addition to or instead of it. In this series, the esophagus, stomach, and first segment of the small intestine are examined (duodenum). During a barium swallow test, fluoroscopy is frequently employed.

Learn more about Barium  here:

https://brainly.com/question/2782682

#SPJ4

The correct answer is d) 17, because the halogens lie on the left side of the noble gases.

To learn more about halogens refer to:

brainly.com/question/1450671

#SPJ1

The solubility of oxygen reduces with increasing temperature, hence cold water can store more dissolved oxygen than warm water. The chemical element with the letters O.

And the atomic number 8 is called oxygen. It belongs to the chalcogen group of the periodic table and is a highly reactive nonmetal that rapidly forms oxides with most elements as well as with other compounds. Understanding the makeup of matter developed together with the creation of the concepts of the elements. The substance has been viewed as either continuous or discontinuous at various points throughout history. It is possible to hypothesise that continuous substance is homogenous, infinitely divisible, and has parts that are all the same size.

Learn more about elements here

https://brainly.com/question/11064416

#SPJ4

The statement that is  true about the elements;

Atom X and Atom Y are in the same row on the periodic table. Option C

We know that the periodic table has to do with an arrangement of the elements in an order that is systematic. As such, when we look at the periodic table, we are looking at a systematization of the elements in a way that it is quite easy for us to be able to identify the elements.

Now we know that the mass number is the sum of the atomic number which in turn is the proton number and the number of the neutrons in the atom.

We know that the atomic number is what would tell us the group to which the element has been found to belong and in this case we can see that element X is just right to element Y in the periodic table.

Learn more about periodic table:https://brainly.com/question/11155928

#SPJ1

Because NH3 molecules in the liquid phase require energy to overcome their intermolecular interactions and transform into free gas molecules, this expression reads NH3(l)— NH3(g). Heat is transferred from the environment to the system during phase shifts.

Ammonia has the chemical formula NH3 and is a colourless gas.Nitrogen and hydrogen make up its composition. Its name in aqueous form is ammonium hydroxide. This inorganic substance smells strongly. It is hazardous and corrosive in its concentrated form. Ammonia has a density of 0.769 kg/m3 at STP, making it lighter than air. It is frequently employed as fertiliser. Additionally, it is employed in the production of explosives like TNT and nitrocelluloseAdditionally, it is employed in the manufacture of soda ash and the Ostwald process to produce nitric acid. A strong alkali, such as sodium hydroxide or calcium hydroxide  2NH4Cl + Ca(OH)2 → CaCl2 + 2H2O + 2NH3(g) is heated with an ammonium salt, such as ammonium chloride NH4Cl, to produce ammonia (g)

learn more about ammonium hydroxide Refer: brainly.com/question/12216996

#SPJ4

An endothermic process from the list would be the melting of ice cubes. Option A.

Endothermic processes are processes that absorb energy from the surrounding. Chemically, endothermic reactions are reactions in which the products are at higher energy level than the reactants.

Endothermic processes are different from exothermic processes. Exothermic processes are processes that gives off energy to the surrounding instead of taking from it.

In order for ice cubes to melt, they need to absorb energy from external sources. In order words, the melting of ice cubes is analogous to an endothermic process.

Burning of sugar and candle give off heat energy to the surrounding. When water vapor condenses, they also give off energy in order to change state from gas (vapor) to liquid. In other words, the burning of sugar and candle, as well as the condensation of rain from water vapor are all exothermic processes.

The only process that is endothermic is the melting of ice cubes.

More on endothermic processes can be found here: https://brainly.com/question/29555731

#SPJ1

According to Bohr's model of the atom, the energy of the photon involved in the transition of a hydrogen atom's electron from "n" is given by the  equation:

E (n) = - [tex]\frac{1}{n^{2} }[/tex] . 13.6 eV

Here, "n" represents the shell number.

Bohr's model of hydrogen puts forward the assumption that the electrons revolve around the nucleus in specific orbits or shells.

Bohr explained the concept of energy of a photon in the hydrogen spectrum in terms of absorption and emission of photons by electrons, which leads to change in energy levels. The energy of a photon is given by the equation:

ΔE =hν

where, h is planck's constant whose value is 6.626 × 10⁻³⁴ Js

and ν is the frequency of the photon.

A drawback of Bohr's model is that it doesn't work for systems consisting of more than one electron.

To know more about Bohr's model of atom here

https://brainly.com/question/24708000

#SPJ4

Yes the paper solvent system appears to be good . As the solvent is uniformly flowed and the color distance shows the good separation.

The Rf value for green color will be comes around 0.4 to 0.5

And Rf. Value for blue color will be around 0.3  which depicts the good separation of substance.

The solvent system expands on the Arrhenius definition by allowing for comparable reactions to occur in many solvents. Since it produces an NH+4 ion upon dissociation, HCl, for example, also functions as an acid in liquid ammonia. The reagents used in chromatography serve to extract, dissolve, and transport the materials without fundamentally altering their chemical structure, which makes them an essential part of conventional separation methods. Solvents are frequently employed in aqueous solutions or in conjunction with other solvents. Cleaning Solvents and Their Types

oxidized solvents

hydrocarbon-based cleaners.

solvents with halogens. Water, ethanol, methanol, and acetone are typical examples of solvents. A substance that can dissolve a specific solute to create a solution with it is referred to as a "solvent."

Learn more about  solvent system here:

https://brainly.com/question/29280797

#SPJ4

Hen because who makes the egg?

Answer:

3Ca(OH)2 = 3(40+2(16+1))

= 222

448.2 ÷ 222 = 2.02mol

6NaOH = 6(23+16+1)

= 240

240 × 2.02mol = 484.5 g

Ozone decomposes to oxygen according to the equation 2O₃(g)⟶3O₂(g). Create the equation that ties the rate expressions for this reaction to the creation of oxygen and the disappearance of O₃.

Given that there are more reactants in a given volume of space, increasing the concentration of reactants improves the likelihood that they will collide in the proper direction. As a result, the reactions rate would increase if the reactants were concentrated more. more often with each other. As a result, the reaction progresses more quickly as the temperature rises. Since the molecules will have less kinetic energy, travel more slowly, and collide less frequently as a result of a lower temperature, the rate of reaction will also be reduced.

Learn more about reaction here-

https://brainly.com/question/13516179

#SPJ4

The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation. (a) The cleavage sites for the trypsin-catalyzed hydrolysis are, AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK.

(b) The following cleavage sites take place during hydrolysis that is catalyzed by chymotrypsin: AQDDYRYIHFLTQHYCFNMMK. Site-selective breakdown of extremely non-reactive peptide bonds also functions as a therapeutically helpful modulator of protein structure and function, providing essential information on the protein sequence. Regulated and selective cleavage is a challenging task and requires chemical reagents to be able to recognize or bind to one or more specific amino acid residues in the peptide chain. On the basis of this concept, we developed a technique that selectively changes the serine residue in a peptide chain using a chemical reagent, causing the peptide backbone to break at the N-terminus of the serine residue. After cleavage, modified residues can be transformed back into their original form. This method may cleave a wide variety of substrates and does so specifically for certain bioactive peptides with post-translational modifications (like N-acetylation and -methylation) and mutations (like D- and -amino acids), which are known to contribute to age-related diseases.

To know more about cleavage please refer: https://brainly.com/question/9161095

#SPJ4

Answer:0.59ATM

Explanation:The total pressure of a mixture of gases is the sum of the partial pressures of the individual gases. In this case, the total pressure of the mixture of helium and neon is 726 torr + 726 torr = 1452 torr. Since the pressure gauge on the container measured a higher pressure than this, we can conclude that a third gas was added to the mixture.

The pressure of the third gas can be calculated by subtracting the total pressure of the helium and neon from the measured pressure of the mixture:

pressure of third gas = 1900 torr - 1452 torr = 448 torr

To convert this pressure to atmospheres, we need to know the conversion factor between torr and atm. One atmosphere is equivalent to 760 torr, so we can use this value to convert the pressure of the third gas to atmospms:

pressure of third gas in atm = 448 torr / 760 torr/atm = 0.59 atm

Thus, the third gas contributed a pressure of approximately 0.6 atm to the mixture. This answer is rounded to two significant figures, as required.

Atomic structure: odd number of F atoms; periodicity: the number of F atoms rises as the atomic number of the central halogen atom rises; ClF, ClF3.

A complicated configuration of negatively charged electrons organized in predetermined shells surrounding a positively charged nucleus is an atom. The majority of the atom's mass is located in this nucleus, which is made up of protons and neutrons (except for common hydrogen which has only one proton). The size of each atom is similar. The angstrom (), which is equal to one tenth of a meter, is a practical measure of length for calculating atomic sizes. A typical atom measures 2-3 in diameter.

Atomic structure physics as we know it now began with J. J. Thomson's discovery of the electron in 1897. Within the outlined energy shells surrounding the nucleus, the negatively charged electrons move in a random way. The amount and arrangement of an atom's electrons determine most of its properties.

Learn more about Atomic structure here:

https://brainly.com/question/14156701

#SPJ4

The nitrogen atoms are present in 20.0 grams of histidine is 2-34 x10²³ atoms of Nitrogen.

1-molecule histidine contains 3 atoms of (N).

given mass of histidine is = histidine =20g

The molar mass of histidine

Number of moles 155g/mol = given mass /Molar mass

20g/155g/mol

= 0.13 mol.

Now, 1-mole histidine has 6.022x10²³ molecules.  

0.13 mole histidine have 6.022X10²³ x 0.13 = 0.78 X10²³ molecules of histidine.

Now, 1 molecule of Histidine contains 3. Nitrogen Histidine atom.

0.78 x 1023 molecules of histidine contains

3x 0.78X10²³ molecules.

2.34 X10²³  Nitrogen atoms.

20g Histidine contains 2-34 x10²³ atoms of Nitrogen.

The molar mass of a substance can be obtained by adding the molar masses of the atomic components. The calculated molar mass can then be used to convert the mass and number of moles of the substance. Use the chemical formula to find the number of atoms for each element in the compound.

Learn more about Molar Mass here:-  https://brainly.com/question/837939

#SPJ4

The correct option for the above question is Potential energy changes to kinetic energy, then some kinetic energy changes to potential energy.

Potential energy is the energy of position that a thing has stored inside it. It is defined as energy stored in an item as a function of its height and is more commonly referred to in this context as gravitational potential energy. Because of the Earth's gravitational pull on the item, the energy is captured. The mass of the automobile and the height at which it is located are two factors that affect the gravitational potential energy of the car at point X.

Potential energy equals m×g×h

M= mass

G stands for gravitational acceleration

Height is H.

Kinetic energy is 0 at the top.

Motion is created by kinetic energy. Whether an item is moving vertically or horizontally, it contains kinetic energy.

Potential energy is transformed into kinetic energy when the automobile rolls down.

Kinetic energy= 0·5 mv²

m= mass

v= velocity

To know more about velocity visit:

https://brainly.com/question/18084516

#SPJ1