A contractor is building a new subdivision. A rectangular piece of land for a new house and yard
is 60 feet wide. The length of the land is longer than the width by a distance of n feet. Which
equation represents the area of the land?
OAA = 3,600 + 60m
OB A = 60n
OC A = 3,600+ n
OD. A = 240 + 2n

Answers

Answer 1

The area of the land is 3600 + 60n.

What is area?

Area is a mathematical concept that expresses the size of a region on a plane or curved surface. The area of an open surface or the boundary of a three-dimensional object is referred to as the surface area, whereas the area of a plane region or plane area refers to the area of a shape or planar lamina.

Given: A contractor is building a new subdivision.

A rectangular piece of land for a new house and yard is 60 feet wide.

The length of the land is longer than the width by a distance of n feet.

So, width = 60 feet

and length = 60 + n feet

Since, the area of rectangular piece of land (A)

Area = length x width

Area = (60 + n) x 60

Area = 3600 + 60n

Hence, the area of the land is 3600 + 60n.

To know more about Area, click on the link

https://brainly.com/question/25292087

#SPJ1


Related Questions

Sketch the space curve represented by the intersection of the surfaces. Surfaces Parameter x2 + y2 + z2 = 4,x+z=2 x=1+sin t Represent the curve by a vector-valued function r(t) using the given parameter. r(t) = (1+sin t)1+Y2cos(t)1+ (1-sin)k (positive y portion) r(t) =| (1 + sin t)i+(-V2cos t)j+ (1-sin)k 、(negative y portion)

Answers

As the point moves along the helix, it traces out a three-dimensional surface in space.The space curve would look like a helix in graph.

1. First, we need to find the vector-valued function r(t) using the given parameter.

2. We can use the parameter x+z=2 to solve for the y-coordinate in terms of t:

y = √(4 − (1+sin t)2 − (1 − sin t)2).

3. We can now substitute this expression into the vector-valued function to obtain:

r(t) = (1+sin t)i+ (√(4 − (1+sin t)2 − (1 − sin t)2))j+ (1-sin)k

4. The space curve represented by the intersection of the surfaces is a helix in a graph.

The space curve represented by the intersection of the surfaces is a helix. It is a three-dimensional curve that can be described by a vector-valued function r(t) with parameter t. The vector-valued function r(t) is given by:

r(t) = (1+sin t)i+ (√(4 − (1+sin t)2 − (1 − sin t)2))j+ (1-sin)k.

The helix can be visualized as a spiral that wraps around a cylinder and is generated by a point travelling around the circumference of the cylinder at a constant speed. This can be observed by noting that the x- and z-coordinates of the vector-valued function are constant and only the y-coordinate changes over time. As the point moves along the helix, it traces out a three-dimensional surface in space.

Learn more about graph here

https://brainly.com/question/17267403

#SPJ4

If a population of weights is normal with a mean of 75 pounds and a standard deviation of 5.9 pounds, the probability an individual from this population will have a weight greater than 72 pounds is 0.31. O True O False

Answers

It is false that the probability of an individual from this population will have a weight greater than 72 pounds is 0.31 instead it is 0.70

According to the question,

Weight of population follows normal distribution

Mean of population : u = 75 pounds

Population Standard deviation : σ = 5.9 pounds

We have to Check if the probability an individual from this population will have a weight greater than 72 pounds is 0.31

Probability that weight is greater than 72 = P( x > 72)

Subtracting by 75 both sides and then dividing by 5.9

=> P( x - 75 / 5.9 > 72 - 75 / 5.9)

Using Z-statistics,

=> P( z > -3/5.9)

=> P( z > -0.508)

=> 1 - P(z < -0.50)

Using Probability distribution table for z,

=> 1 -  0.305

=> 0.70

Which is not equal to 0.31

Hence, It is false that Probability that weight is greater than 72 is 0.31

To know more about Probability here

https://brainly.com/question/30034780

#SPJ4

Consider a set of cards that has four cards labeled 1, 3, 5, and 7. Suppose you pick two cards, without replacement, and obtain the mean of the two numbers that are drawn from the set. Which of the following tables shows the sampling distribution? a.) Sample (n = 2) x̄ S1 = {1, 1} 1 S2 = {1,This problem has been solved!You'll get a detailed solution from a subject matter expert that helps you learn core concepts.Consider a set of cards that has four cards labeled 1, 3, 5, and 7.Suppose you pick two cards, without replacement, and obtain the mean of the two numbers that are drawn from the set

Answers

Answer:

one 2

one 3

two 4's

one 5

one 6

Step-by-step explanation:

We can use the combination formula to derive how many sets of two can be obtained from this set of 4 numbers. We are using the combination formula instead of the permutation formula because, in this situation, order doesn't matter; the mean of 1 and 3 is the same as the mean of 3 and 1.

[tex]_nC_r = \dfrac{n!}{r!(n-r)!}[/tex] where [tex]n[/tex] is the number of things to choose from and [tex]r[/tex] is the number of things we are choosing. Hence the equation for this problem is:

[tex]_4C_2 = \dfrac{4!}{2!(4-2)!}[/tex]

[tex]_4C_2=\dfrac{24}{2(2)}[/tex]

[tex]_4C_2 = 6[/tex]

So, there are 6 ways to pick 2 cards from a total of 4. We can lay out these 6 possibilities from the given numbers on each card:

(1, 3)     (3, 5)     (5, 7)

(1, 5)     (3, 7)

(1, 7)

Then, we can calculate the mean, or average, of each.

2           4           6

3           5

4

Finally, we can conclude that the distribution of the means for each possible set of number pairs is:

one 2

one 3

two 4's

one 5

one 6


I need help with this please help me

Answers

T(-3,3)

To move back

T(3,-3)

Option A


May I have Brainly

Which step shows the result of applying the subtraction property of equality?
Step
1
2
3
4
Step 1
Step 2
Step 3
O Step 4
(12x+8) +4=3
Solution
3x+2+4=3
3x+6=3
3x=-3
X=-1

Answers

Step 3 shows the result of applying the subtraction property of equality

What is Equation?

Two or more expressions with an Equal sign is called as Equation.

The given equation is 1/4(12x+8)+4=3.

We need to find which step has the property of substitution.

The Subtraction Property of Equality states that an equal value subtracted or removed from two equal items will result in a new equal amount.

Given step 1 is 3x+2+4=3

Opened the brackets on left side and multiplied with 1/4.

Step 2: 3x + 6 = 3.

Added the numbers on the left.

Step 3: 3x = -3

Equal value subtracted or removed from two equal items will result in a new equal amount. So Subtracted both sides by 6.Step 3 shows the result of applying the subtraction property of equality

Step 4: x = -1

Divided both sides by 3.

Hence, in step 3 we have used the property of subtraction.

To learn more on Equation:

https://brainly.com/question/10413253

#SPJ1

data were collected on the number of days per week that members visit a certain fitness center. the values varied from 0 to 7, and a distribution of relative frequencies for the values was created. let the random variable x represent the number of days per week that a member visits. the mean of x is 3.12. which of the following statements is the best interpretation of the mean? responses each member visits the fitness center 3 or 4 days per week. each member visits the fitness center 3 or 4 days per week. the average number of days that each member visits the fitness center is 3.12 days per week. the average number of days that each member visits the fitness center is 3.12 days per week. half the members visit the fitness center 3 days per week or less, and the other half visit 4 days per week or more. half the members visit the fitness center 3 days per week or less, and the other half visit 4 days per week or more. the long-run average resulting from repeated sampling of members of the fitness center will approach 3.12 days per week. the long-run average resulting from repeated sampling of members of the fitness center will approach 3.12 days per week. for a random sample of members selected from the population, the average number of visits for the sample will be 3.12 days per week.

Answers

The statement that is the best interpretation of the mean is that the long-run average resulting from repeated sampling of members of the fitness center will approach 3.12 days per week.

The data of the number of days members visited a certain fitness center varied from 0 to 7.

The mean of the random variable x = 3.12

The mean of the random variable is also known as the long-run average value of a random variable.  

Hence, we conclude that the best interpretation of the mean in the given question is that the long-run average resulting from repeated sampling of members of the fitness center will approach 3.12 days per week.

To know more about random variable:

https://brainly.com/question/17238189

#SPJ4

6. If g(x)=-3x²-2 , find g(-2).

Answers

Answer:

g(-2) = -14

Step-by-step explanation:

We just need to substitute -2 for x

g(-2) = -3 * (-2)^2 - 2 = -3 * 4 - 2 = -12 - 2 = -14

HELP PLEASE all I need is the answer of b and c. The whole of the table is correct

Answers

Answer: b) 5/18 c) 5

b. You have a table that says 1-6 x 1-6 multiply 6x6 to get 36, that is your total number of squares. This number will also be our denominator.

Now you need to count the number of 1s (just the blue ones). You have 10 number 1s. This will be our numerator.

Let’s combine our two numbers into a fraction. Our numerator of 10 and denominator of 36 = 10/36

We need to simplify this number since it is not in its smallest possible form. A number that will factor into both 10 and 36 is 2.

After dividing both the top and bottom by 2 we get a simplified fraction of 5/18. This is our answer.

Part C.

First thing to know is that we already have the denominator of these fractions, it’s 36 all of the fractions we find will use the denominator 36.

Let’s start with 2, we have 8/36 which simplifies to 2/9

Next, 3: we have 6/36 which simplifies to 1/6

Next 4: we have 4/36 which simplifies to 1/9

Next 5: we have 2/36 which simplifies to 1/18

So it looks like the number 5 is the one that will simplify to become our answer!

Find the range of the relation

Answers

Answer:

1st {-6, -3, 0, 3, 6}

Step-by-step explanation:

range is the output that is "y", so the range is a set of {-6, -3, 0, 3, 6}

15. A student has a stone. He wants to find its density. (a) He pours 110 cm^3 of water into a measuring cylinder. And then, he places the stone in the water. The water surface in the measuring cylinder moves up. The volume of water and stone is 150 cm^3. What is the volume of stone? (1 mark)​

Answers

The volume of the stone if, The volume of the water is 110 cm³, and The volume of the water and the stone is 150 cm³, is 40 cm³.

What is volume?

The capacity occupied by a three-dimensional solid shape is known as volume. It is difficult to visualize in any shape, yet it may be compared among shapes. For instance, a compass box has a larger volume than an eraser placed inside of it.

Given:

The volume of the water = 110 cm³,

The volume of the water and the stone = 150 cm³,

Calculate the volume of the stone as shown below,

The volume of stone = The volume of the water and the stone - The volume of the water

The volume of stone = 150 - 110

The volume of stone = 40

Thus, the volume of the stone is 40 cm³

To know more about volume:

brainly.com/question/13807002

#SPJ1

Compare the function 3x + 2y = 8 to the function graphed below, then identify which statement is true.

The two functions have the same y-intercept.

The two functions have the same x-intercept.

The y-intercept of the graphed function is greater than the y-intercept of the function 3x + 2y = 8.

The x-intercept of 3x + 2y = 8 is greater than the x-intercept of the graphed function.

Answers

The two linear functions have the same y-intercept. Then the correct option is A.

What is a linear equation?

A connection between a number of variables results in a linear model when a graph is displayed. The variable will have a degree of one.

The linear equation is given as,

y = mx + c

Where m is the slope of the line and c is the y-intercept of the line.

The function 3x + 2y = 8 and the other function is graphed.

Convert the standard linear function into slope-intercept form. Then we have

3x + 2y = 8

2y = 8 - 3x

y = 4 - (3/2)x

The y-intercept of the linear function is 4 and the y-intercept of the graphed line is also 4.

The two capabilities have a similar y-catch. Then, at that point, the right choice is A.

More about the linear equation link is given below.

https://brainly.com/question/11897796

#SPJ1

Find the vertex of the graph of f(x) = |0.25x − 0.75|. vertex ?

Answers

The vertex of the graph (3, 0)

What is Vertex of graph?

A vertex or node is the basic building block of a graph in discrete mathematics, and more precisely in graph theory. An undirected graph is made up of a set of vertices and a set of edges, whereas a directed graph is made up of a set of vertices and a set of arcs.

According to question

when f(x) = 0

that's the minimum point, the vertex, or the intersection of two lines,  g(x) = 0.25x − 0.75 and h(x) =  0.75 - 0.25x

Therefore

find the intersection of Two line which are

⇒ y = x/4 - 3/4

⇒ 4y = x - 3 → First line

⇒ y = 3/4 - x/4  

⇒ 4y = 3 - x → Second line

So x - 3 = 3 - x

2x = 6 ,

x = 3

And y = 0

hence the vertex of f(x) = (3, 0)

To learn more about Vertex , check out

https://brainly.com/question/29030495

#SPJ1

PLEASE ANSWER QUICK!!
Consider the functions and f(x)=|x|-2 and g(x)=2f(x).
a. Complete the table.
b. Describe the graph of f. How does each point on the graph of f map to the corresponding point on g?

Answers

The function f(x) is an absolute function and the function g(x) will be twice the function f(x). The table is completed below.

What is a function?

A function is an assertion, concept, or principle that establishes an association between two variables. Functions may be found throughout mathematics and are essential for the development of significant links.

The functions are given below.

f(x) = |x| - 2 and g(x) = 2 f(x)

The function g(x) is rewritten as,

g(x) = 2 (|x| - 2)

g(x) = 2|x| - 4

The function f(x) is an absolute function and the function g(x) will be twice the function f(x).

x           f(x) = |x| - 2               g(x) = 2f(x)

-2                0                               0

-1                -1                               -2

0                -2                              -4

 1                -1                               -2

2                0                                0

More about the function link is given below.

https://brainly.com/question/5245372

#SPJ1

Isosceles trapezoid ABCD is shown.
A
B
D
C
Which three statements are correct?
ZBAC ZCAD
ZACD ZACB
ZADC ZBCD
AD
AB
AC
BC
CD.
BD
ہے

Answers

From the given Isosceles trapezoid ABCD, the three correct statements are:

∠ADC ≅ ∠BCD

AD ≅ BC

AC ≅ BD

What is Isosceles trapezoid?

An isosceles trapezoid is a trapezoid with equal base angles and hence equal left and right side lengths.

Particularly in isosceles trapezoids, there are unique correlations. "Equal legs" is what the term "isosceles" denotes. Non-parallel sides on isosceles trapezoids have the same lengths. The "legs" are another name for these equal sides.

A triangle with two equal sides is said to be isosceles. Also equal are the two angles that face the two equal sides. A triangle with two congruent sides is referred to as being isosceles, in other words.

Thus, three correct statements are -

∠ADC ≅ ∠BCDAD ≅ BCAC ≅ BD

To know more about isosceles trapezoid refer to:

https://brainly.com/question/8644421

#SPJ1

PLEASE ANSWERE ASAP

If BC = 16.7 ft, what is AY?

Answers

Answer:

Since YA=AX, XB=BZ, ZC=CY, it follows that A, B and C are the midpoints of the sides TX, XZ, ZY. AB, BC, AC are parallel to the sides and equal to their half. In fact, AB = YC=ZC. Therefore BC=AY.)

Good luck;)

Step-by-step explanation:

If >p and >Q are complementary angles m>p = 7x +3, and m>q= 16x -5, find m>p

Answers

Answer:

m<P = 31°

Step-by-step explanation:

Use this symbol < for angle, not <.

<P and <Q are complementary.

That means that their measures add to 90°.

m<P + m<Q = 90°

Now we substitute 7x + 3 for m<P and 16x - 5 for m<Q.

7x + 3 + 16x - 5 = 90

Solve for x.

23x - 2 = 90

23x = 92

x = 4

m<P = 7x + 3 = 7 × 4 + 3 = 31

Answer: 31°

t=10-x identify to dependent and independent variable

Answers

Answer: t is the dependent variable  and x the independent variable

Step-by-step explanation: t is the dependent variable it depends upon the values of x that we put in.

x is the independent variable as we can use whatever values we want for x it is not affected by t

Consider the function f (same as in the previous problem) defined on the interval [0, 4) as follows, F(x) = { 2/2 x. x € [0,2]. 2, x € [2, 4]Find the coefficients Cn of the eigenfunction expansion of function ff(x) = Σ[infinity], n=1 cnyn(x), where y... for n = 1,2,3,... are the unit eigenfunctions of the Regular Sturm-Liouville system - y^n = ꟾλy, y’(O) = 0, y(4) = 0Note: Label your eigenfunctions so the eigenfunction for the lowest eigenvalue corresponds ton = 1. Therefore, use 2n – 1 instead of 2n +1.C= ___

Answers

Coefficient Cn is determined by Cn = 1/2 ∫[0,2] (x+2)yn(x) dx

To find the coefficients Cn of the eigenfunction expansion of a function f(x), f(x) must be expanded with the eigenfunction yn(x). The expansion of f(x) with respect to the eigenfunction yn(x) is given by

f(x) = Σ[∞], n=1 cnyn(x)

To find the coefficient cn, we need to compute the dot product of f(x) and yn(x).

cn = (f,yn) = ∫[0,4]f(x)yn(x)dx

Since the eigenfunctions yn(x) are orthonormal, the scalar product is given by

cn = ∫[0,4]f(x)yn(x)dx = ∫[0,2]f(x)yn(x)dx + ∫[2,4]f(x)yn(x)dx

Since f(x) = 2/2 x for x in [0,2] and f(x) = 2 for x in [2,4], compute the coefficient cn as I can do it.

cn = ∫[0,2](2/2x)yn(x)dx + ∫[2,4](2)yn(x)dx

= ∫[0,2]xyn(x)dx + ∫[2,4]2yn(x)dx

= 1/2 ∫[0,2] (xyn(x) + 2yn(x)) dx

= 1/2 ∫[0,2] (x+2)yn(x) dx

Therefore, the coefficient Cn is given by

Cn = 1/2 ∫[0,2] (x+2)yn(x) dx

Read more about Coefficient Cn on brainly.com/question/17145751

#SPJ4


The sum of an infinite geometric series with first term a and common ratio r < 1 is given by The sum of a given a/1-r infinite geometric series is 300, and the common
ratio is 0.1. What is the second term of this series?

Answers

The second term of the series will be 27.

What is a Geometric progression?

Geometric Progression (GP) is a type of sequence where each succeeding term is produced by multiplying each preceding term by a fixed number, which is called a common ratio. This progression is also known as a geometric sequence of numbers that follow a pattern.

Sum to infinity = a/1-r

where s = 300

r = 0.1

a = 300 (1 - 0.1)

a = 300 (0.9)

a = 270

The second term of the progression will be = ar

Second term = 270 x 0.1

Second term = 27

Learn more about Geometric progression: https://brainly.com/question/24643676

#SPJ1

Samuel went to the grocery store and purchased cans of soup and frozen dinners.
Each can of soup has 300 mg of sodium and each frozen dinner has
450 mg
of
sodium. Samuel purchased 5 more frozen dinners than cans of soup and they all
collectively contain 6000 mg of sodium. Write a system of equations that could be
used to determine the number of cans of soup purchased and the number of frozen
dinners purchased. Define the variables that you use to write the system.

Answers

A system of equations that could be used to determine the number of cans of soup purchased and the number of frozen dinners purchased is; 300a + 450b = 6000 and a + 5 = b.

The variables x and y respectively represents  cans of soup and frozen dinners and a and b represents number of cans of soup and frozen dinners.

How to find a system of simultaneous equations?

Let cans of soup be denoted by x

Let each frozen dinner be denoted by y

Now, we are told that each can of soup has 300 mg of sodium and each frozen dinner has 450 mg. Thus;

x = 300

y = 450

It is said that Samuel purchased 5 more frozen dinners than cans of soup  and they all collectively contain 6000 mg of sodium.

Let the no. of cans of soup be 'a' and no. of frozen dinner be 'b'. Thus, we will have the equation as;

ax + by = 6000

a(300) + b(450) = 6000  

300a + 450b = 6000      ------(1)

We are told that Samuel purchased 5 more frozen dinners than cans of soup. This can be represented by the equation;

a + 5 = b    ------(2)

Read more about System of Simultaneous Equations at; https://brainly.com/question/16863577

#SPJ1

find the most general antiderivative or indefinite integral. check your answers by differentiation cos2x-sec^2x

Answers

The general anti derivative or indefinite integral of the function

cos2x - sec²x is 1/2 sin2x + tan x + C .

The given function is of the form : cos2x - sec²x

Now we will use the indefinite integral on the above expression:

∫cos2x - sec²x

This can be broken into :

∫cos2x -  ∫sec²x

Now we will integrate them separately:

∫cos2x, we will use u-substitution.

Let 2x = u

Differentiation both sides we get:

2 dx = du

or, dx = 1/2 du

Hence we will use this value:

∫cos2x

= ∫cos u · 1/2du

= 1/2 ∫ cos u du

=1/2 sin u + C , where C is a constant.

Again we will do the second part of the integral:

∫sec²x

= tan x + C

Hence the required integral will be:

1/2 sin2x + tan x + C .

Now we will use differentiation to check the integral

d/dx (1/2 sin2x + tan x + C )

= d/dx (1/2 sin2x) + d/dx (tan x) + d/dx (C)

= cos 2x + sec² x

To learn more about indefinite integral visit:

https://brainly.com/question/29133144

#SPJ4

Given the geometric sequence twenty-seven sixteenths comma negative nine eighths comma three fourths comma and continuing comma what is a6?

a
two ninths
b
negative two ninths
c
negative 81 over 128
d
81 over 128

Answers

The 6th term of the geometric sequence 27/16, -9/8, 3/4..... is - 2/9

The correct answer option is option B

What is the 6th term of the geometric sequence?

Given: 27/16, -9/8, 3/4.....

nth term = ar^(n-1)

Where,

First term, a = 27/16

Common ratio, r = -9/8 ÷ 27/16

= -9/8 × 16/27

= -2/3

6th term = ar^(n-1)

= 27/16 × -2/3^(6-1)

= 27/16 × -2/3^5

= 27/16 × -32/243

= - 2/9

In conclusion, negative two ninths is the 6th term of the geometric sequence.

Read more on geometric sequence:

https://brainly.com/question/24643676

#SPJ1

evaluate the following expression. express your answer as a fraction or a decimal number rounded to four decimal places. 11C9/11P4

Answers

The result of the expression 11C9 / 11P4 is 1 / 144

The given expression is

11C9 / 11P4

The permutation is defined as the method of arranging the numbers or object in order

The combination is defined as the method of selecting the numbers or object from a collection without any order

The given expression is

11C9 / 11P4

Find the value of each term

11C9 = 11! / (11-9)! × 9!

= 55

11P4 = 11! / (11-4)!

= 7920

Substitute the value of each term in the expression

The expression will be

11C9 / 11P4 = 55/7920

= 1/144

Therefore, the result is 1/144

Learn more about permutation here

brainly.com/question/27058178

#SPJ4

A checkerboard is 8 squares long and 8 squares wide. The area of each square is 14 square centimeters. Estimate the perimeter of the checkerboard.

Answers

The perimeter of the checker board  118.4 cm

Area of each square = 14 sq. cm.

What is the length?

Distance is measured in length. Length has the dimension of distance in the International System of Quantities. The majority of measurement systems choose a base unit for length from which all other units are derived. The meter serves as the foundational unit of length in the International System of Units.

The square root of area is the length of one side

[tex]\text { lengthofeachsquare }=\sqrt{14}=3.7 \mathrm{~cm}[/tex]

[tex]\text { lengthofoneside }=8 * 3.7=29.6 \mathrm{~cm}[/tex]

[tex]P=4 a[/tex]

[tex]=4 * 29.6=118.4 \mathrm{~cm}[/tex]

[tex]\text { Perimeterofthecheckerboard }[/tex]

Therefor we get the perimeter of the checker board  118.4 cm

To learn more about length visit

https://brainly.com/question/8552546

#SPJ1

Two different meal combinations at a chicken restaurant have the same number of total calories.
- The first meal has 8 chicken nuggets and a large order of fries.
- The second meal has 12 chicken nuggets and a small order of fries.
- The larger order of fries contains 288.5 calories.
- The small order of fries contains 193.5 calories.
Which equation and solution can be used to determine n, the number of calories in each chicken nugget?
A 12 n-288.5=8 n-193.5 ; n=24.1
B 8 n+193.5=12 n+288.5 ; n=23.75
C 193.5+12 n=288.5+8 n ; n=24.1
D 8 n+288.5=12 n+193.5 ; n=23.75

Answers

The equation which can be used to determine n, the number of calories in each chicken nugget would be 193.5+12 n=288.5+8n

And n = 24.1

Option (C) is correct.

What is a linear equation?

A linear equation is an equation that describes a straight line. Linear equations have the form y = mx + b, where x and y are variables and m and b are constants. The constant m is the slope of the line, and the constant b is the y-intercept, which is the point where the line crosses the y-axis.

To derive this equation, we can start with the fact that the two meals have the same number of total calories. This means that the number of calories in the first meal is equal to the number of calories in the second meal. We can represent this relationship with the equation:

8 nuggets * calories/nugget + 193.5 calories = 12 nuggets * calories/nugget + 288.5 calories

We can then rearrange the terms on the left and right sides of the equation to get the equation in the form given in option C:

193.5 + 12 n = 288.5 + 8 n

Finally, we can solve this equation for n by subtracting 8n from both sides and then dividing both sides by 4:

n = (193.5 - 288.5) / 4 = (-95) / 4 = -23.75

Therefore, the number of calories in each chicken nugget is 24.1 calories.

Hence, option (C) is correct.

To learn more about linear equations, visit:

https://brainly.com/question/14323743

#SPJ1

Let f:R→S be a surjective homomorphism of rings with identity.
(a) If R is a PID, prove that every ideal in S is principal.
(b) Show by example that S need not be an integral domain.

Answers

Every ideal of S is principal when f:R⇒S be a surjective homomorphism of rings with identity.

In a homomorphism, corresponding elements of two systems behave very similarly in combination with other corresponding elements. For example, let G and H be groups. The elements of G are denoted g, g′,…, and they are subject to some operation ⊕.

In algebra, a homomorphism is a structure-preserving map between two algebraic structures of the same type (such as two groups, two rings, or two vector spaces). The word homomorphism comes from the Ancient

Let f:R⇒S be a surjective homomorphism of rings with identity.

We have to find if R is a PID, prove that every ideal in S is principal.

We know that,

Let I be the ideal of S

Since f is sufficient homomorphism.

So, f⁻¹(I) is an ideal of R.

Since R is PID so ∈ r ∈ R such that

f⁻¹(I) = <r>

I = <f(r)>

Therefore,

Every ideal of S is principal when f:R⇒S be a surjective homomorphism of rings with identity.

To learn more about Homomorphism problems visit :

brainly.com/question/19865639

#SPJ4

Advanced Algebra - please help

Answers

Answer:

Below

Step-by-step explanation:

Only the middle three are tri -nomials  ( three terms)

the third one reduces to  (x+ 2)^2

Answer:

3

Step-by-step explanation:

(x+2)^2

What’s 7 1/3 - 5 1/6 ?
Pls hurry !!!

Answers

First off, we can start by converting thirds into sixths.

1 • 2 = 2
3 • 2 = 6

Now, let’s simplify and subtract:

7 2/6 - 5 1/6 = 2 1/6

7 1/3 - 5 1/6 = 2 1/6, which in decimal form is the equivalent of approximately 2.16.

If a 5 1/4 inch line on a map represents a 9 mile road, how many miles would be represented by a 3 1/2 line

Answers

A (3 + 1/2) inches line represents a real distance of 5.985 miles.

How many miles would be repesented by a (3 + 1/2) inch line?

First, we know that a (5 + 1/4) inch line on a map represents a 9 mile road, then the conversion from miles to inches is given by the quotient between these two, we will get:

9mi/(5 + 1/4) in = 9mi/(5.25) in = 1.71 mi/in

So, any distance in inches can be multiplied by the above number to get the corresponding measure in miles.

Then for (3 + 1/2) inches we will get:

(3 + 1/2) in*1.71 mi/in = 5.985 mi

So a line of (3 + 1/2) inches has represents a distance of 5.985 miles.

Learn more about distances:

https://brainly.com/question/7243416

#SPJ1

I need a little bit of help with this one

Answers

Step-by-step explanation:

boy come ladies yer wait for you

hvb-amor-jon

Other Questions
An annual pass to the local zoo is$40.00. The daily pass is $12.00.What is the least number of timesyou can visit the zoo with theannual pass to make it the betterdeal? as a manager, how would you prefer a nonofficial leader respond to a challenge in rolling out a collaboration tool? umama wants to enable user experience virtualization (ue-v) by configuring group policy settings. two important settings that she needs to configure are the setting storage location and settings template catalog location. which of the following is true of this scenario? Question (Leo has an allowance of $80 from doing chores. He puts $22 into hissavings account. Leo plans to buy 4 new shirts this month. How muchmoney can Leo spend on each shirt?) the first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation and have the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin? how hard students work can depend on their expectations of what they can accomplish. the expectations of their teachers. all answer choices are correct. the expectations of their parents. Quotes should take up no more than ___ percent of your paper.OA. 80OB. 25O C. 10O D. 50 One angle measures 170, and another angle measures (6k 44). if the angles are vertical angles, determine the value of k. k = 12 k = 20 k = 21 k = 126 the proper level of government intervention is unclear when dealing with a monopoly. group of answer choices true false Which of the following is a typical amount of petty cash a small business would want to keep on hand the anticodon of a particular trna molecule is the anticodon of a particular trna molecule is complementary to the corresponding mrna codon. complementary to the corresponding triplet in rrna. the part of trna that bonds to a specific amino acid. changeable, depending on the amino acid that attaches to the trna. catalytic, making the trna a ribozyme. Graph the inequality on the axes belowx+ 5y TRUE/FALSE. ensure maximum return for its investment, the process and procedures for selling scrap and surplus must cover a broad range of activities including segregation and storage, weighing and measuring, delivery, negotiation, supplier selection, and payment. Help pls thanks urgent !!! PLEASE HELP ME ITS TIMED!!! Find the area of a rectangle with the sides of x+7 and 3x-4 cold water can hold more dissolved oxygen than warm water because the solubility of oxygen decreases as temperature increases. T/F The parabola of y= has a vertex of (3, - 2) and a focus of (3, - 2 1/16) opens downward Find the least common denominator of these fractions.3/8 5/18 agents are sales representatives for manufacturers or wholesalers and usually are hired on a commission basis.