can anyone give me ideas or write an essay about Let's care for animals

Answers

Answer 1

Answer:

reasons why we should care for animals

Explanation:

in this world God give us the animals I mean everything in the world ways to keep take care of them . but sometimes we don't do our Duty as humans . god knew that he needed someone to help in hand . that is why we created mankind to take care of animals and all other things in this world including the world itself . these are some of the reasons why we should care for animals .

sometimes you don't dates for us to play with. animals can also be our companions . they can help us in many ways like , beginners happy whenever we are sad . in human lives there are mostly dogs and cats that are all over our societies and then the make is happy.

sometimes animals have been used as messengers to send messages to other people like our friends and families so they could know what's going on around you . in the olden days most animals were used as messengers to send messages from one place to another.

animals are also used as securities to protect our properties from dangers and other bad things that can harm families workshops and other working area .

these are some of the reasons why animals are important and are supposed to be taking care of .

Answer 2
^ |
|. What they said
|

Related Questions

Using 2y + 6 = 5, which of
the following statements is not
correct? *
O A) 6 and 5 are coefficients
O B) It has 3 terms
O C) y is known as the variable
O D) The above is an equation
0 This is a required question​

Answers

Explanation:

The correct answer is A

6 and 5 are constants, 2 is the coefficient.

[tex] \blue{\huge{\red{\boxed{\green{\mathfrak{AWSWER}}}}}} [/tex]

A) 6 and 5 are coefficients

[tex] \orange{\underline{\huge{\bold{\textit{\green{\bf{EXPLANATION}}}}}}} [/tex]

2y+6=5

2y=(-1)

y=(-0.5)

coefficients --> 2

constants--> 6&5

variable--> y

equation--> 2y+6=5


Look carefully at the picture and describe what you say do not say the name of the person please just describe what you see thanks

Answers

Answer:

a soccer player or a sports player winning or celibratiing becouse they look happy

hope I helped

Using the chart of word affixes, which is the most likely meaning of the word epidermis​

Answers

Answer:

A.

Happy learning!

--Applepi101

Answer: The outer layer of skin

Explanation:

Trust me love

The art of the chicano movement, and the movement of the Chicano art What connection does the author make between literacy and art

Answers

Hi. You did not enter the text to which this question refers, which makes it impossible for it to be answered. However, I will try to help you as best I can.

To answer this question, you will need to read the text it is related to. During this reading, you will be able to identify the connection between literacy and art through the relationship that the author establishes between these two elements, that is, the author will demonstrate a type of relationship between art and literacy, capable of creating good and positive for something or someone.

What word in Excerpt B has the same root word as
intercept from Excerpt A?
Excerpt A:
Excerpt B:
This would allow Eve to intercept the message as
it is typed into the computer, before it is
encrypted.
-The Code Book,
Simon Singh
What word part is used to change the part of speech of
the word intercept to the new part of speech of the
word in Excerpt B?
What part of speech is this new form of the word, as
used in Excerpt B?

Answers

Answer:

The word that has the same root word as "intercept" is: interception.

The word part which is used to change the part of speech of the word intercept to the new part of speech is: -ion (suffix)

The part of speech this new form of the word is: noun

Explanation:

We can easily see that the words "intercept" in excerpt A and "interception" in excerpt B are very similar. What is the difference between them? Notice that "interception" has some extra letters: -ion. This is a suffix, that is, a group of letters added to a word with the purpose of changing it. While "intercept" is a verb, "interception" is a noun, precisely because of the addition of the suffix. "Interception" means the action of intercepting, that is, of preventing someone or something that is moving toward a destination.

Answer:

1) A- Interception

2) C- -ion

3) C- noun

Explanation:

The ozone layer contains about _____percent of atmospheric ozone.
a) 60
b) 75
c) 90
d) 99

Answers

Answer:

60

Explanation:

The earth is shielded from the dangerous UV rays of the sun by the ozone layer, an area of the stratosphere with high ozone concentrations. The ozone layer contains about 60% atmospheric ozone. The correct option is a.

The region of the upper atmosphere between 15 and 35 km (9 and 22 miles) above the surface of the Earth that is known as the ozone layer, also known as the ozonosphere, contains relatively high concentrations of ozone molecules (O₃).

Due of its ability to absorb a variety of UV light, ozone is incredibly valuable. Even low-energy UV radiation can cause an ozone molecule to split into a regular oxygen molecule and a free oxygen atom.

Thus the correct option is a.

To know more about ozone, visit;

https://brainly.com/question/29795386

#SPJ4

Generations of Hawaiians have told the story of Hawai'iloa, a Polynesian navigator who accidentally landed upon
the Hawaiian islands. Hawai'iloa fell in love with the fertile lands, where coconuts grew in abundance. The island
of Hawaii was named in his honor. However, some people question the authenticity of the legend, claiming that
parts of it grew from the imaginations of the people who passed it down from generation to generation. A second
legend about early migration to Hawaii features Pa'ao. He was a Tahitian priest who heard the wind tell him to
steer toward the islands, which his family then colonized.
Do It!
These stories reflect Hawaiian
A generosity
B choreography
C mythology
D monarchy

Answers

Answer:

Answer: D

Explanation:

The correct option is D. These stories reflect the Hawaiian monarchy.

From 1810, when Kamehameha I (1738-1819) brought all the islands under his rule, to the time the monarchy was abolished under Lili'uokalani, Hawaii was a united kingdom under a single monarch for only eighty years.

Why was the Hawaiian monarchy overthrown?

The Queen had been ousted by pro-American economic forces after she rejected constitutional restrictions on her authority. Hawaii was too little and militarily insignificant to exist in a world of aggressive imperialism, particularly on the part of Japan, the new government knew. It was eager for annexation by America.

When Queen Liliuokalani was coerced into abdicating by a group of businessmen and sugar planters, Hawaii's monarchy was abolished. The coup caused the Kingdom of Hawaii to be dissolved two years later, incorporated as a U.S. territory, and eventually admitted as the 50th state into the union.

Thus, The right answer is D. The Hawaiian monarchy is reflected in these tales.

Learn more about the Hawaiian monarchy here:

https://brainly.com/question/2688991

#SPJ6

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

Which is NOT an example of reference material?

Answers

opinions are NOT an example of reference material

define the 5 plot orders

Answers

Answer:

1. Exposition/introduction- in storytelling the exposition is the additional information, most often provided through narration, that makes readers familiar with the world of your story.

2. Rising action- The rising action of a story is the section of the plot leading up to the climax, in which the tension stemming from the story's central conflict grows through successive plot developments

3. Climax/turning point- the turning point or climax is the point of highest tension in a narrative; it’s the most exciting and revealing part of a story. It leads the rising action into the falling action before a story is resolved and reaches the conclusion

4. Falling action- Falling action occurs right after the climax, when the main problem of the story resolves.

5. Resolution/denouement- is the conclusion of the story's plot. It is when the story begins to slow down and work towards its end, tying up loose ends of the plot.

:333

Explanation:

Which word from paragraph 1 helps the reader understand the meaning of the word compassion in paragraph 1?

A. admired
B. cared
C. dignity
D. hope

Answers

Answer:

B cared

Explanation:

Answer:

B cared

Explanation:

compassion - cared

The mood of a story is the

Answers

Answer:

Please add a picture or something

Explanation:

I would to help you since I love books and writing! :)

add a picture , or options so we know what ur talking abt

Which sentence from the advertisement insults people who don't have a Superforce 80?
A There is a limited supply.
B Everyone is asking for a Superforce 80.
C Are you in for a treat?
D Don't be left behind in the 20th century.

Answers

I think it’s D? It’s calling people who don’t have a Superforce 80 outdated.

Haven`t they reserved the rooms?(Change into passive)

Answers

‘Haven’t the rooms been reserved by them?’

Regards,
ArmyCee:)

Real or not real?
(Get the reference?)

Answers

Answer:

Not real

Explanation:

Life is a lie… ;)

Answer:

Explanation:

really

Read Josh's draft.
Floating Entertainment
During the mid-19th century, before television or movies existed, people enjoyed forms of entertainment that are no longer common today.
For example, people who lived in areas along the Mississippi River that were far from large cities depended on showboats. Showboats were boats
on which plays were performed
An actor named William Chapman was the first person to build a showboat. He called his showboat the "Floating Theater." Actors lived on
the boat and traveled along the river. The showboat stopped at small towns to perform plays.
Showboats were very popular but were discontinued when the Civil War began in 1861. They became popular again in the late 1870s.
However, by the early 1900s, many settlements along the Mississippi had grown into larger towns with dance halls and movie theaters. As a result,
Mississippi showboats began to lose their appeal. By 1910, people were heading to movie theaters big time.
Josh wants to revise his last sentence.
Is Josh's decision to revise his last sentence correct?
O 1. No, because the information in the sentence provides a strong conclusion,
O 2. No, because the information in the sentence is essential to the topic's main idea.
O 3
Yes, because the sentence includes a factual statement instead of a personal opinion.
4. Yes, because the sentence contains slang and differs in style from the rest of the draft.
Question #4
Language 2-12 CA 2010

Answers

Explanation:

Technology has the power to affect not only education but also culture, religion and personal thoughts and beliefs. While the world population is continually growing, our global world seems to be getting smaller as we are able to connect to people in a way that was never imagined. Radio and television were among the early contributors to this new form of mass media and played a role in affecting world political views and religious beliefs as well as changing how we view literacy in an educational setting.

(from The Strange Case of Dr. Jekyll and Mr. Hyde, by Robert Louis Stevenson)

Read the passage carefully and then answer the question.

Two doors from one corner, on the left hand going east the line was broken by the entry of a court; and just at that point a certain sinister block of building thrust forward its gable on the street. It was two storeys high; showed no window, nothing but a door on the lower storey and a blind forehead of discoloured wall on the upper; and bore in every feature, the marks of prolonged and sordid negligence. The door, which was equipped with neither bell nor knocker, was blistered and distained. Tramps slouched into the recess and struck matches on the panels; children kept shop upon the steps; the schoolboy had tried his knife on the mouldings; and for close on a generation, no one had appeared to drive away these random visitors or to repair their ravages.

Mr. Enfield and the lawyer were on the other side of the by-street; but when they came abreast of the entry, the former lifted up his cane and pointed.

"Did you ever remark that door?" he asked; and when his companion had replied in the affirmative. "It is connected in my mind," added he, "with a very odd story."

"Indeed?" said Mr. Utterson, with a slight change of voice, "and what was that?"

The word in bold is an example of what kind of tone?

A. uninviting.

B. confusing.

C. exciting.

D. thrilling.

Answers

Unfortunately, I don't see a word in bold. I'd love to help, but I need the word.

Taking good notes helps you do all of the following except

Answers

Answer:

Deemphasizing

Explanation:

Which area of a notes organized would contain the following information

Answers

The section that will most likely contain this information is the vocabulary. The vocabulary section is the part that includes words that are unknown or new to the organizer...

Sort the tiles to show the causal relationships between the events.
The pigs oppress the animals.
The animals rebel against Mr. Jones
Mr. Jones oppresses the animals.
The pigs take over as leaders

Answers

Answer:

The pigs oppress the animals- The pigs take over as leaders.

Mr. Jones oppresses the animals- The animals rebel against Mr. Jones.

Explanation:

Causal relationships refer to the phenomena when one thing results in another. In other words, the event when one event triggers or brings upon a reaction and causes another event is known as a causal relationship. It is also known as a cause-effect relationship.

In George Orwell's "Animal Farm", causal relationship happens in the following pairs-

The pigs oppress the animals (CAUSE)- (EFFECT) The pigs take over as leaders.

Mr. Jones oppresses the animals(CAUSE) - (EFFECT) The animals rebel against Mr. Jones.

Answer: The answers are in order first to last look at the explanation and pic below!

Explanation: Trust Me! It is correct!

Sort the tiles to show the causal relationships between the events.

Mr. Jones oppresses the animals. The animals rebel against Mr. Jones. The pigs take over as leaders. The pigs oppress the animals.

Did it on Edge it is correct! I hope this helps! If you found any of my answers helpful please like and choose my answer as Brainliest.

I would appreciate it!  Good luck everyone! :)

Legal over the counter drugs can be displayed in a pharmacy or a shop?

True
False
Maybe

Answers

True yhunininomoibunij

Fill in the correct wo A number of girls..... fighting in school. (was, were, have)​

Answers

Answer:

A number of girls "were" fighting in school.

Explanation:

A number of girls was fighting in school.

who is a kpop stand here?

Answers

Answer:

im a kpop stand :D

I stand bts and other groups!

Explanation:

Answer:

Meeeee I Stan

Explanation:

hi guys I'm new here ​

Answers

Hello!!!!!!!

How are you??

Answer:

Hii!!

Explanation:

How are you???...

The purpose of paraphrasing Shakespeare's text is to?

Answers

Answer:

in my opinion Shakespeare's text is to show what true love is. that no matter what happens they will be true loves forever

Explanation:

if u want u can add on this is just my opinion

What would you like to change about yourself if you can?

Answers

Answer:

anything and ajdnissjjd

Explanation:

djsjjjddk

Answer:

My reactions

Explanation:

I often find myself becoming very defensive and angry when it comes to people who have thoughts and ideas that oppose mine. It's not that they oppose mine, but when they are being lied to then I get upset. I would like to become someone who is slow to anger

We cannot absolutely know that all these exact adaptations are the result of preconcert. But when we see a lot of framed timbers, different portions of which we know have been gotten out at different times and places and by different workmen-Stephen, Franklin, Roger, and James, for instance-and when we see these timbers joined together, and see they exactly make the frame of a house or a mill, all the tenons and mortices exactly fitting, and all the lengths and proportions of the different pieces exactly adapted to their respective places, and not a piece too many or too few-not omitting even scaffolding-or, if a single piece be lacking, we can see the place in the frame exactly fitted and prepared to yet bring such piece in -- in such a case, we find it impossible not to believe that Stephen and Franklin and Roger and James all understood one another from the beginning, and all worked upon a common plan or draft drawn up before the first lick was struck.

Answers

Answer:

The answer is allusion

Explanation:

Hope this answer helps you :)

Have a great day

Mark brainliest

Answer:

The answer is Allusion

22. What
expresses feelings with a patterned meter?

Answers

Answer:

fgtrtsefdghfyuipytrdtyi87oytryuiygf

Explanation:

Re write: "She never seems to succeed even though she works hard." with However

Answers

she never seems to excel in whatever she does although she pours all her time and attention into it.

Which sentence is INCORRECT?
Group of answer choices

"I hate broccoli!" Jack yelled at dinner.

Martha asked, "Is this due tomorrow?"

"Sam never does his homework" the teacher said sadly.

"Barney is for little babies," she said.

Answers

Answer:

"Sam never does his homework" the teacher said sadly.

Explanation:

The sentence is incorrect.

Why? well because it does not use correct punctuation

When using dialogue you must end the dialogue with some sort of punctuation. it could be any type of punctuation such as a comma or a exclamation mark but if it does not have any of those then the sentence is not grammatically correct

Other Questions
Read the excerpt from Flannery O'Connor's "The Life You Save May Be Your Own." The ugly words settled in Mr. Shiftlet's head like a group of buzzards in the top of a tree. The simile in this excerpt compares Mr. Shiftlet to a group of buzzards. the ugly words to the top of the tree. a group of buzzards to the top of a tree. the ugly words to a group of buzzards. Lauren is tutoring students at the library on Saturday. If she is at the library for a total of 6 hours and she helps eachstudent, one at a time, for 7 of an hour, how many students does she tutor?3 Indicate whether the statement is true or false.This is Ag work please answer correctly ____ 1. Plants are used directly and indirectly to meet human needs____ 2. A steer is a female cow that has given birth ____ 3. You have to live on a farm to be an FFA member____ 4. We believe are the first two words of the FFA creed____ 5. Thank you notes are required to get a job____ 6. Only female turkeys gobble____ 7. A first year FFA member is called a Greenman____ 8. To be in FFA you have to be in an Agriculture class____ 9. It is okay to let a non FFA member wear your FFA jacket____ 10. You have to be in FFA to have an animal project____ 11. It is okay to leave blanks on a job application____ 12. A male turkey is called a Tom____ 13. While in FFA official dress it is acceptable for makes to wear khaki pants____ 14. A cow is a ruminant animal ____ 15. Cows have only one stomach compartment____ 16. Turkeys grow to full maturity in about 4 to 5 months____ 17. The FFA is only in the state of Texas____ 18. The FFA emblem plow stands for labor and tillage of the soil____ 19. There are 3 paragraphs in the FFA creed____ 20. A turkey under sixteen weeks of age is called a roaster____ 21. Wild turkeys are white in color____ 22. Freeze branding is the only way to identify cattle ____ 23. A job application is one of the first barriers that you encounter before you are employed____ 24. The gestation period of cattle is only 3 months ____ 25. Domesticated turkeys cannot fly____ 26. A T-bone steak is considered a by- product____ 27. The official colors of the National FFA are blue and gold Multiple ChoiceIdentify the choice that best completes the statement or answers the question.____ 28. Which act established vocational agriculture courses in 1917?____ 29. What did FFA stand for before it was changed?____ 30. The official colors of the FFA are ____ 31. How should the FFA jacket be worn?____ 32. List the parts of the FFA emblem____ 33. Plants impact what environmental factors?____ 34. When measuring a horse 1 hand= _____ inches ____ 35. Who wrote the FFA creed?____ 36. What provides the foundation of the FFA emblem?____ 37. The FFA emblem has how many symbols?____ 38. The highest FFA degree members can earn is____ 39. The first line of the FFA motto is ____ 40. List the official Dress for females ____ 41. What are the last few words of the first paragraph of the FFA creed____ 42. In ___________ the FFA opened membership to girls____ 43. ______ believe in less dependence on ________ and more power in bargaining____ 44. The Symbol on the FFA Emblem that signifies Labor and tillage of the soil is ____ 45. What does polled mean?____ 46. breeds of cattle are known for milk production ____ 47. What do you call a neutered male cow?____ 48. What do you call a male sheep or goat that has been castrated when its young?____49. Swine breed most used for pets____ 50. The most popular goat breed used for FFA projects Qu otras formas adquiere el racismo en Amrica Latina? Opinan que existe el racismo entre nosotros Por qu? si pueden responder ahora mejor, en 3 dias se me termina el trimestre y no doy mas de trabajos jasjdjas plz help me i cant fail this class Write an equation that represents the line Solve for x in this equation.7^3x-17 = 49^x After the neolithic revolution, humans begin to settle in small villages. what allowed the growth of largest cities and towns?A) the human desire for bigger buildingsB) surplus food that could b stored and sharedC) the invention of slavery D) none of the above **WILL GIVE BRAINLIEST PLEASE HELP**- flakes of cold snow drifting slowly- In sequence to make the ground - their permanent residence**what poetic device is used by saying the ground is the snows permanent residence What are the base units the SI units are based on There are 6 blue marbles, 4 green marbles, and 2 red marbles. You choose 2 marbles. What is the chance that they will be blue? La funcin de la levadura en quimica Collective noun for drawer Ethan is 1.6 metres tall, Uzma is 154 cm tall.Work out how much taller Ethan is than Uzma. What statement best describes Napoleon and the church?a. Restored the church, but had a clear separation of church and state agreementb. Made the national officially Catholic expelling all ProtestantsC. Made the nation officially Protestant banning all other religions 4/8 =?/2 please answer Which of the scatterplots have no correlation? Check all that apply.On a graph, points curve up and down.On a graph, points are grouped together to form a horizontal cluster.On a graph, points are grouped together to form a vertical cluster.On a graph, points are grouped together and decrease.On a graph, points are scattered over the graph.Please Help : ) Write an equation to represent the relationship between x and y: 76. In the diagram below, lines land mareparallel. Both are intersected bytransversal t.What is the value of x? What are human rights