generally, a high ratio could lead investors and creditors to view the company as being very risky.

Answers

Answer 1

Generally, a high Debt to owner's equity ratio could lead investors and creditors to view the company as being very risky.

What is the debt-to-equity ratio?

The debt-to-equity ratio is a financial metric that shows how much debt and shareholder equity were utilized to finance the assets of a company. The ratio, often known as risk, gearing, or leverage, is closely related to leveraging. A debt-to-equity ratio of roughly 2 or 2.5 is generally seen as good, though it differs by industry. According to this ratio, the corporation receives around 66 cents of every dollar invested in debt and the remaining 33 cents in equity. If the debt-to-equity ratio is 1.5, it means that the corporation has $1.50 in debt for every $1 in equity. A company's debt-to-equity ratio reveals how much debt it has in relation to investor equity.

To learn more about the debt-to-equity ratio click on the given link:

https://brainly.com/question/27993089

#SPJ1


Related Questions

refers to having other people help you by reading the draft and communicating with you about its strengths and weaknesses.

Answers

Evaluating is the process of getting assistance from others by having them read your manuscript and discuss its advantages and disadvantages with you.

What does assessing accomplish?

A programmed, precise, intervention, or initiative's effectiveness in achieving its objectives can be studied scientifically by using evaluation. Evaluations help identify the aspects of a programme or effort that are successful and those that could be improved.

What is an illustration of evaluation?

Review Sentence Samples He paused to inspect the gold-plated jeweler. In order to make rescue efforts easier, assess the run-out beneath the rapid. To employ in the driver, we first examine a variety of compression algorithms. I look for opportunities, he claimed.

To know more about evaluating visit:

https://brainly.com/question/28404595

#SPJ4

according to the video lectures, members of societies with individualistic values .

Answers

According to the video lectures, members of societies with individualistic values values personal goals and independence

What is meant by the individualistic values?

Autonomy, freedom, self-actualization, assertiveness, and a sense of individuality are all examples of individualist values. Collectivism, which is said to be more prevalent in non-Western countries, is based on interpersonal interactions that foster social cohesion through the proper performance of roles, responsibilities, and obligations.

Individualistic values, on the other hand, prioritize the interests of the individual over the interests of members of the in-group and the outsiders; as a result, they place more value on an individual's independence, self-reliance, and self-realization than on the interests of the community, society, or country.

When you describe someone as individualistic, you're referring to their preference for thinking and acting independently of others rather than following in their footsteps. A culture can also be characterized as individualistic if it promotes such behavior. most creatives

Read more on individualistic values here: https://brainly.com/question/454904

#SPJ1

A newly issued bond has a maturity of 10 years and pays a 7% coupon rate (with coupon payments coming once annually). The bond sells at par value. (i) What are the convexity and the duration of the bond? (ii) Find the actual price of the bond assuming that its yield to maturity immediately increase from 7% to 8% (with maturity still 10 years). (iii) What price would be predicted by the duration rule? What is the percentage error of that rule? (iv) What price would be predicted by the duration-with-convexity rule? What is the percentage error of that rule?

Answers

A recently issued bond has a 10 year maturity and a 7% coupon rate. Gain expected is equal to (12.30*0.01) plus (0.5*272.9*(0.012)), which equals 13.66%.

What traits distinguish a mature person?

Age has no influence on maturity; maturity is decided by how you choose to act and respond to various life experiences.

Price of zero coupon bond at 8%=(1000/(1.08^13.05))=366.29

Price of zero coupon bond at 9%=(1000/(1.09^13.05))=324.78

Price of 6% coupon bond 8%= (60*((1-(1.08^-13.05))/0.08)+(1000/(1.08^13.05))=841.57

Price of 6% coupon bond 9%=(60*((1-(1.09^-13.05))/0.09)+(1000/(1.09^13.05))=774.93

Zero coupon bond

Actual loss =(324.78 - 366.29)/366.29=11.33%

Predicted loss =((-12.08*0.01))+(0.5*157.20*(0.01^2))=11.29%

Price of 6% coupon bond

Actual loss =(774.93-841.57)/841.57=7.92%

Predicted loss = (-12.30*0.01)+(0.5*272.9*(0.01^2))=10.94%

Part B

Price of zero coupon bond at 8%=(1000/(1.08^13.05))=366.29

Price of zero coupon bond at 7%=(1000/(1.07^13.05))=413.56

Price of 6% coupon bond at 8%= (60*((1-(1.08^-13.05))/0.08)+(1000/(1.08^13.05))=841.57

Price of 6% coupon bond at 7%=(60*((1-(1.07^-13.05))/0.07)+(1000/(1.07^13.05))=916.22

Zero coupon bond

Actual gain =(413.56 - 366.29)/366.29=12.91%

Predicted gain =((12.08*0.01))+(0.5*157.20*(0.01^2))=12.87%

Price of 6% coupon bond

Actual gain =(916.22-841.57)/841.57=8.87%

Predicted gain = (12.30*0.01)+(0.5*272.9*(0.01^2))=13.66%

To know more about zero coupon bond visit:

https://brainly.com/question/29216800

#SPJ4

Fredo is an ethically challenged attorney. While he was in law school, he was investigated for allegedly cheating a few times, but managed to graduate because nothing was ever proven. After obtaining his law license, Fredo's practices continued to be ethically questionable. He often used tacles that challenged the limits of professional responsibility. One of Fredo's clients was an older gentleman, Vieta 96 year-old multi- millionaire real estate investor. Viet was dealing with legal issues involving a complicated divorce related to his extramarital relationship with a local real estate developer, Staria. Viet had been experiencing considerable physical and mental health challenges for the past four years, and he heavily relied on Fredo to manage his personal affairs and provide business advice Viet was deeply in love with Starla, but also passionately committed to ensuring the continued success of the family business on which his four children and eight grandchildren depended. Fredo told Viet that he could arrange matters so that Viet could happily live out his final years in the Caribbean with Start Butto for this to happen, Viet would have to pay a large legal fee to Fredo, and 2name Fredo as a major beneficiary in Viet's will; and (3) give Fredo power of attorney over all of Vier's assets, including his ownership shares in the business Viet agreed to Fredo's demands. He gave Fredo power of attorney and changed his will so that upon his death, Fredo would receive half of Viers estate. The other half went to Start Viet also paid the unusually large legal fee. At that point, Fredo agreed to proceed with negotiations in Vier's divorce. Shortly after the divorce, Viet had a severe heart attack and immediately died. QUESTION Which of the following is true regarding Fredo's dealing with Viet? o Fredo has unduly influenced Viet. o Fredo has committed fraudulent misrepresentation and caused Viet to experience duress o Fredo tres caused Viet to experience duress. o Fredo tios caused Viet to experience duress and unduly intuenced Viet o Fredo has not committed any wrongdoing, unless it can be proven that Viet locked mental capacity during his transactions with Fredo: In that case, Fredo nas caused Viet to experience duress.

Answers

Note that in the above case study, it is correct to state that ""Fredo has unduly influenced Viet and caused Viet to experience duress." Hence, his acts can be termed as highly unethical.

What is undue influence in law?

A contract is said to be induced by "undue influence" when the parties' relations are such that one of the parties is in a position to dominate the will of the other and exploits that position to gain an unfair advantage over the other.

Undue influence is illegal. However, it is a hard issue with few convictions. However, excessive influence is a form of constructive fraud.

Thus, besides crossing the boundaries of professional limits, Fredo can be charged for fraud in the above case.

Learn mroe about undue influence:
https://brainly.com/question/15250833?
#SPJ1

omega inc. is a company that manufactures automobile parts. the goods produced are standardized, and they are produced in large volumes to avoid stock-outs. the company uses highly specialized machinery for production. in the given scenario, omega inc. most likely uses a . a. combined layout

Answers

Omega Inc. is a company that manufactures auto parts. The organization uses very advanced machinery for manufacturing. In the scenario, Omega Inc. probably uses a product layout.

Which of the four types of layouts are they?

Four basic layout kinds are process, product, hybrid, and fixed position layouts. In this section, we study the fundamental characteristics of each of these categories. The details of how some of the major types were developed are then examined.

Definitions of product layout and process layout is?

A product layout is a type of layout design where the components needed to create the product are arranged in a single line in the proper sequence.

To learn more about product layout here:

https://brainly.com/question/14272069

#SPJ4

1.A casual dining chain has experienced over 100 cases of food poisoning in several U.S. cities. The parent company of the chain immediately acknowledged the situation and relayed information about its ongoing investigation. The spokespeople stressed that "our primary concern is always the health and safety of our customers." At this point, the scenario would most likely be considered a(n) __________ issue.
Multiple Choice
• an advertorial
• public relations
• event marketing
• network marketing
• indirect advertising

Answers

As the spokespeople stressed that "their primary concern is always the health and safety of our customers." At this point, the scenario would most likely be considered a public relations issue. The Option B is correct.

What is public relations in marketing?

In marketing, public relations means set of techniques and strategies related to managing how information about an individual or company is disseminated to the public and most especially the media. The primary goals of public relations are to disseminate important company news or events, maintain a brand image and put a positive spin on negative events to minimize their fallout.

A company public relations may occur in the form of press release, news conference, interviews , social media posting etc. Every entity operating in the public eye faces spread of information about them or their practices to the public.

In conclusion, as public relations is an industry unto itself, any attempt to portray oneself in a certain way to others can be considered a form of public relations.

Read more about public relations

brainly.com/question/20313749

#SPJ1

the sales-volume variance is sometimes due to . question 15 options: unexpected increase in manufacturing labor time unexpected increase in the use of quantities of inputs of raw material quality problems leading to customer dissatisfaction the difference between selling price and budgeted selling price

Answers

The discrepancy between the conventional fixed cost per unit and the actual price per unit

Give an explanation of variable costs and an illustration.

Variable costs are prices that change according to volume. Raw materials, piece-rate labor, production supplies, commission, delivery costs, packaging equipment, and credit card fees are examples of variable costs. The term "Cost of Goods Sold" is occasionally used in accounting statements to refer to variable manufacturing expenses.

What exactly are variable and fixed costs?

Definition. When a corporation produces more or fewer things, its fixed costs remain constant. This is what is meant by the term "fixed cost." A cost that will vary according to changes in production levels is known to as a variable cost.

To know more about variable cost visit:

https://brainly.com/question/27853679

#SPJ4

to format a range so that all values greater than $500 appear in red, which of the following can you use? T/F

Answers

"To format a range so that all values greater than $500 appear in red,  you can use conditional formatting rule" is True Option A

What is conditional formatting rule?

Generally, To format a range so that all values greater than $500 appear in red, you can use a conditional formatting rule. This is a feature in spreadsheet programs such as Micro/soft Excel and Go/ogle Sheets that allows you to apply formatting to cells based on the values in those cells or based on a formula.

To create a conditional formatting rule to highlight values greater than $500 in red, you can do the following:

Select the range of cells you want to apply the formatting to.

In the ribbon or menu bar, go to the "Home" or "Format" tab and click on the "Conditional Formatting" button.

In the conditional formatting options, select "Greater Than" or "Less Than" from the list of rules.

In the value or formula field, enter "500" or "$500".

Select the red fill or red text formatting that you want to apply to the cells that meet the condition.

Click "OK" or "Apply" to apply the formatting rule to the selected cells.

You can also use a formula in the conditional formatting rule to apply formatting based on more complex conditions. For example, you could use the formula "=A1>500" to apply the formatting to cells in column A where the value is greater than 500.

In summary, you can use a conditional formatting rule to format a range so that all values greater than $500 appear in red.

Read more about conditional formatting rule

https://brainly.com/question/16014701

#SPJ1

As a provider of funds to a corporation, owning which of the following corporate securities will give you the most control rights?
A. short-term bank loan
B. long-term bond
C. preferred stock
D. common stock.... Common stock usually allows voting rights which could be used to exercise control over a firm.

Answers

As a provider of funds to a corporation, owning which of the following corporate securities will give you the most control rights is B. long-term bond.

What is corporation?

A corporation serves as the business entity  which is been owned by the  shareholder(s), who elect a board of directors to oversee the organization's activities however the corporation is liable for the actions as ell as  finances of the business  however the shareholders are not.

It should be noted that the Long-term bonds serves as opne that term to maturity of between 10 years and 30 years however these kind of  bonds generally pay a higher interest rate  compare to theshort-term and intermediate bonds and in thiscase the Bond issuers  can pay higher interest rate for the bonds in exchange .

Therefore, option B is correct.

Learn more about corporation at:

https://brainly.com/question/13551671

#SPJ1

an increase in the price of oil is also a signal to oil suppliers to invest more in exploration, to search for alternatives, and to increase recycling.

Answers

This assertion is accurate. A rise in oil prices also encourages oil producers to spend more on exploration, look for alternatives, and boost recycling.

What kind of inflation does an increase in oil prices bring about?

Supply shocks that impede production, like natural disasters, or drive up production costs, like high oil prices, can limit overall supply and cause "cost-push" inflation, in which the cause of price increases is a disruption in supply.

The ecology benefits from high oil costs, right?

One way or another, the negative impact of high gas, oil, and coal costs on consumers is positive for the environment since it reduces the demand for fossil fuels. On the other hand, because they promote supply, the effects of high prices on producers are harmful to the environment.

Learn more about "cost-push" inflation: https://brainly.com/question/18072639

#SPJ4

The two most basic policies associated with employment stability are: *
1 poin
employment for life and guaranteed minimum wage.
full-time and part-time.
incentive plans and piece-rate plans.
follow demand exactly and hold employment constant.
job enrichment and job enlargement.

Answers

The two most basic policies associated with employment stability are follow demand exactly and hold employment constant. Option D is correct.

What is Employment Stability?

Employment stability is the length of time an employee works at their current position without being let go. In order to encourage a sense of employment stability, companies must take action.

Five Strategies for Finding More Employment Stability:

Focus on what is effective. Learn to keep work and life separate.Join the journeys together.At the very least, fix the technical issues.Pay attention to the inner voice.

However Companies may improve retention, attract top talent (word spreads when employees know that their employment is stable), and foster a productive workplace atmosphere by offering consistent, stable positions to workers.

Thus Option D is correct.

Learn more about Employment Stability refer:

https://brainly.com/question/28325905

#SPJ1

If the number of skilled workers to frame houses in a particular city has declined in the last few months, that factor would
A) none of these.
B) more likely affect the demand for housing.
C) more likely affect the supply of housing.
D) not affect supply or demand.

Answers

If the number of skilled workers to frame houses in a particular city has declined in the last few months, that factor would more likely affect the supply of housing.

Does the lack of investment permanence affect a community's ability to develop?

Yes, a lack of infrastructure that is designed for the future discourages investors from funding developments.

Which of the following influences real estate supply?

Labor and material availability, governmental regulations, and community attitudes toward development are all factors that affect the supply of real estate. Interest rates, buyer demographics, and consumer financial health are among factors that affect demand.

What use does a property's location serve in preventing financing?

Redlining is the practice of withholding a loan for housing in a particular neighborhood from a creditworthy applicant, even though the person may otherwise be qualified for the loan.

To Know more about supply of housing.

https://brainly.com/question/18697996

#SPJ4

suppose nike and adidas are considering whether to develop new advertising campaigns. for each pair of strategies, the blue triangle at the top of each square shows nike's payoff and the yellow triangle at the bottom of each square shows adidas's payoff, in billions. use this information to complete the sentences.

Answers

The best outcome for Nike is to Advertise and for Adidas to not Advertise

If Adidas chooses not to advertise, their best result will happen if Nike chooses not to advertise. The Nash equilibrium for this advertising game is for Nike to choose to Advertise and for Adidas to not Advertise

What does marketing in a firm entail?

Marketing your company through advertising is one strategy to boost sales or enhance audience awareness of your goods or services. Your advertising may contribute to a customer's initial perceptions of your company before they interact with you and make a purchase.

Advertising is an effective technique that you may use to draw clients, educate them about your products, and gain their trust. The majority of businesses utilize some form of advertising to market their goods and services.

The  benefit of advertising are:

Increased customer reachincrease consumer knowledge of your brand and company.promote the advantages of your goods and services.provide details about your company.

Therefore, Nike will be better off without advertising as their sales are up based on the table but Adidas have to advertise if they want to bring their sales up.

Learn more about advertising from

https://brainly.com/question/14227079
#SPJ1

Jose's company decided to implement a push strategy for its new line of health care products. Based on this, what strategy will the company most likely use?

Answers

Jose's company decided to implement a push strategy for its new line of health care products. Based on this, the strategy the company will most likely use is personal selling.

A company is an organization that usually includes a group of individuals or businesses that have been authorized by the state to operate as a single entity and recognized by law for certain purposes. The first companies were established with a charter. Most governments now allow the registration of new companies.

While there are different types of companies, they are generally classified according to the laws of the country in which they are incorporated based on their ability to issue shares or the purpose for which they are incorporated. A corporation can be a general corporation or a sole proprietorship, depending on the number of shareholders.

To know more about Company here-

https://brainly.com/question/14245835

#SPJ4

Ducto is a small company in Aurora, CO that makes duct-tape wallets. Ducti discovered that there is a large demand for these type of wallets and has, in fact, decided to expand its product line to include bags as well. Clearly, some consumers have a favorable evaluation of Ducti products. To have a favorable evaluation, the first step for consumers is

Answers

To have a favorable evaluation, the first step for consumers is to  experience problem recognition

Problem recognition is an important first step in the process of evaluating commodities as a consumer. It occurs when a consumer realizes they have a need or desire that is not met by their current products. This realization can trigger the consumer to evaluate potential solutions to their problem or need.

Problem recognition can be influenced by a variety of factors, such as personal experiences, advertising, recommendations, and changes in one's circumstances or environment. Once a problem has been recognized, the consumer may begin to search for information and evaluate potential solutions to determine which one best meets their needs and preferences. In the given case, since there was a large demand for wallets, then only Ducti decided to expand its product line.

Read more about problem recognition on:

https://brainly.com/question/13371536

#SPJ4

Vertical Analysis of Income Statement
For 20Y2, Fielder Industries Inc. initiated a sales promotion campaign that included the expenditure of an additional $40,000 for advertising. At the end of the
year, Leif Grando, the president, is presented with the following condensed comparative income statement:
3. PR.14-05B
Fielder Industries Inc.
Comparative Income Statement
For the Years Ended December 31, 20Y2 and 20Y1
20Y2 20Y1
Sales $1,300,000 $1,180,000
Cost of goods sold 682,500 613,600
Gross profit $617,500 $566,400
Selling expenses $260,000 $188,800
Administrative expenses 169,000 177,000
Total operating expenses $429,000 $365,800
Income from operations $188,500 $200,600
Other income 78,000 70,800
Income before income tax $266,500 $271,400
Income tax expense 117,000 106,200
Net income $149,500 $165,200
Required:
1. Prepare a comparative income statement for the two-year period, presenting an analysis of each item in relationship to sales for each of the years. Round to
one decimal place. Enter all amounts as positive numbers.
Fielder Industries Inc.
Comparative Income Statement
For the Years Ended December 31, 20Y2 and 20Y1
20Y2 Amount 20Y2 Percent 20Y1 Amount 20Y1 Percent
Sales $1,300,000 % $1,180,000 %
Cost of goods sold 682,500 % 613,600 %
Gross profit $617,500 % $566,400 %
Selling expenses 260,000 % 188,800 %
Administrative expenses 169,000 % 177,000 %
Total operating expenses $429,000 % $365,800 %
Income from operations $188,500 % $200,600 %
Other income 78,000 % 70,800 %
Income before income tax $266,500 % $271,400 %
Income tax expense 117,000 % 106,200 %
Net income $149,500 % $165,200 %
2. The net income as a percent of sales has
. All the costs and expenses, other than selling expenses, have maintained their approximate cost as a percent of sales relationship between 20Y1 and 20Y2.
Selling expenses as a percent of sales, however, have . Apparently, the new advertising campaign been successful.
The increased expense produced sufficient sales to maintain relative profitability. Thus, selling expenses as a percent of sales have

Answers

As a percentage of sales, net income has fallen. Other than selling charges, all costs and expenses between 20Y1 and 20Y2 remained roughly the same as a percentage of sales.

Give a brief account on income statement.

One of a firm's financial statements, an income statement displays the sales and expenses the company incurred within a specific time period. Managers and investors can determine whether a company made money during the reporting period by looking at the income statement.

Charitable organizations are not required to prepare an income statement but are instead required to disclose financial statements. Instead, they produce a comparable statement that contrasts funding sources with program costs, overhead costs, and other operating commitments. The declaration of actions is another name for this sentence. The donor constraints on the funds received and spend are used to further categorize revenues and expenses in the statement of activities.

To solve the question.

1. Comparative Income Statement and working note are attached below.

2. As a percentage of sales, net income has fallen. Other than selling charges, all costs and expenses between 20Y1 and 20Y2 remained roughly the same as a percentage of sales.

However, the percentage of selling expenses to sales has gone up. It appears that the new marketing initiative has been successful.

To know more about, income statement, visit :

https://brainly.com/question/14308954

#SPJ1

which of the following is a source of gaining wealth whereby corporate raiders either push companies to change their corporate strategy to one that will benefit stockholders, or charge a premium for stock when the company wants to buy it back? a stock option greenmail self-dealing on-the-job consumption risk capital

Answers

The statement that is a source of gaining wealth whereby corporate raiders either push companies to change their corporate strategy to one that will benefit stockholders, or charge a premium for stock when the company wants to buy it back is: B. Greenmail.

What is Greenmail?

Greenmail can be defined as the way of buying more shares  or additional shares from a company so as to make it look like another company what to takeover which inturn will enables the company to rebuy or repurchase the same shares as a premium because of the fear of been taking over.

Some investors tend to engage in this act buy trying to threaten a company with what is called hostile takeover.

Greenmail is a  source of generating wealth based on the fact that corporate raiders will tend to push companies to change their corporate techniques  to the one that will be of benefit to stockholders.

Therefore we can conclude that the correct option is B.

Learn more about greenmail here:https://brainly.com/question/13798855

#SPJ1

12. if an asset-price bubble begins to form, assuming the central bank responds, how is it likely to respond, and what will be the effect on the mp curve? mishkin, frederic s. economics of money, banking and financial markets, the (what's new in economics) (p. 512). pearson education. kindle edition.

Answers

Raising interest rates is the appropriate response to developing equity or real estate price bubbles.

Although it is never popular, officials must do this if they are to fulfil their responsibility of stabilising the financial and economic system. The culprits behind some of the most disastrous recessions in history are asset price bubbles. Asset bubbles that were followed by severe economic downturns include the stock market bubble of the 1920s, the dot-com boom of the 1990s, and the real estate bubble of the 2000s.

When an asset bubble explodes, it can be extremely disastrous for people and firms who invested too late. Asset price bubbles are comparable to Ponzi or pyramid schemes in this way. When asset bubbles burst, investors' net worth is destroyed, and exposed enterprises fail, potentially igniting a chain reaction of debt deflation and financial panic that can spread to other areas of the economy and produce the recessionary phase of higher unemployment and decreased output.

Know more about economic here:

https://brainly.com/question/14787713

#SPJ4

Recognition of a recourse liability will make a loss on sale of receivables larger than it would otherwise have been. True

Answers

I Recourse Liabilities means any obligation, guaranty or indemnity by a Member under any loan to the Company or any Operating Company.

What is the recognition of liabilities?

Recourse Liabilities are the amounts owed by the Partnership that are not Nonrecourse Liabilities or Partner Nonrecourse Liabilities.

A recourse is a legal agreement that grants the lender the right to repossess the pledged collateral if the borrower fails to meet the debt obligation. The lender's legal right to collect is referred to as recourse. Lenders benefit from recourse lending because they are guaranteed some repayment, whether in cash or liquid assets.

Companies that use recourse debt have a lower cost of capital because lending to that firm carries less underlying risk. Recourse Liabilities are the amounts owed by the Partnership that are not Nonrecourse Liabilities or Partner Nonrecourse Liabilities.

A recourse is a legal agreement that grants the lender the right to collect on the loan.

To learn more about Recognition refer to:

https://brainly.com/question/28427592

#SPJ4

For a monopolistically competitive firm in long-run equilibrium:
a. price will equal marginal cost.
b. price will equal average total cost.
c. marginal revenue will exceed marginal cost.
d. economic profits will be some positive amount.

Answers

For a monopolistically competitive firm in the long-run equilibrium price will equal the average total cost. Thus, option 'B' is the correct option.

What happens to price in long run in monopolistic competition?

In long-run equilibrium, a monopolistically competitive firm's pricing will be equal to its average total cost. A monopolistically competitive corporation never generates any economic profits in the long run. The price is equal to the average total cost when a producer is earning no economic profits, or P = ATC.

Businesses in monopolistic competition continue to produce at a level where marginal cost and marginal income are equal over the long term. But when more businesses enter the market, the demand curve will have moved to the left.

Learn more about monopolistic competition, here:

https://brainly.com/question/29407851

#SPJ1

thinking ahead to retirement, assume you will be able to earn a 10 percent return on your investments. if you have saved $230,000 and expect to live 17 more years when you retire, calculate the annual annuity you will be able to receive for 17 years. (enter your answer as a positive number rounded to 2 decimal places.)

Answers

Retirement is the cessation of one's employment, occupation, or active working life. [1] Another way to semi-retire is to work fewer hours or with less job. When they are old or unable to work due to health issues,

many people decide to retire. People may also retire when they are eligible for private or public pension benefits, while others are compelled to do so due to legislation governing their jobs or because their physical conditions make it impossible for them to continue working (due to disease or accidents). [2] The concept of retiring was first popularized in the late nineteenth and early twentieth centuries in the majority of nations. Low life expectancy previously

learn more about Retirement here:

https://brainly.com/question/20751552

#SPJ4

Partners active in a partnership business should have their share of partnership profits based on the followinga. Percentage of net income after salaries are paid to inactive partnersb. A combination of salaries plus interest based on average capital balances.c. A combination of salaries and percentage of net income after salaries and any other allocation basis.d. Salaries only

Answers

Partners active in a partnership business should have their share of partnership profits based on the following: c. A combination of salaries and percentage of net income after salaries and any other allocation basis.

A partnership is an association where parties, referred to as enterprise companions, comply with cooperation to increase their mutual interests. The partners in a partnership can be people, groups, interest-based corporations, schools, governments, or combos.

A partnership is a relationship between or more people to do trade or business. everybody contributes money, property, labor, or talent, and shares the earnings and losses of the commercial enterprise. publication 541, Partnerships, has statistics on the way to shape a partnership.

Learn more about the partnership here:

https://brainly.com/question/14034519

#SPJ4

The most accurate way to assess training effectiveness is to conduct pretests and posttest and then train all the employees, true or false?

Answers

True, Conducting pretests and posttests before teaching all of the staff is the most precise technique to gauge the effectiveness of the training.

How would you define effectiveness?

Productivity is the capability to attain the obvious result or result. The quality of usefulness is the ability to achieve the desired goal projected result or leave a significant, long-lasting impression.

What does business effectiveness mean?

Being effective requires focused upon that "right" things that help business goals and give economic value.. Few teams today are successful in linking their present job to more general organizational goals the most precise technique to gauge the effectiveness of the training.

To know more about effectiveness visit :

https://brainly.com/question/13954961

#SPJ4

c. as the number of non-correlated stocks increase in a portfolio, overall variance will likely decrease

Answers

The aforementioned assertion is accurate; as a portfolio's non-correlated stock holdings grow, its total variance will probably decrease.

What transpires if a portfolio's stock count rises?The projected systematic risk should stay a constant as more stocks are added to the portfolio, bringing the aggregate risks closer to it.Given that the variance (or standard deviation) of the portfolio represents the x-axis of the efficient frontier, modern portfolio theory suggests that portfolio variance can be decreased by selecting asset classes with a low or negative correlation, such as stocks and bonds.If the characteristic of the sample has little variance, the correlation coefficient will be smaller. An illustration of this pattern is the relationship between IQ and academic success. Only including kids with comparable academic performance reduces the correlation.

The complete question is,

Genuine or fake. A portfolio's total variance will probably decrease as the proportion of non-correlated equities grows.

To learn more about Non-correlated stock refer to:

https://brainly.com/question/17101079

#SPJ4

The Lorenz curve and the line of perfect income equality will be one and the same in an economy if 20% of all households receive 20% of all income.
True or False

Answers

False: A Lorenz curve is a graphical representation of income inequality or wealth inequality.

What is the purpose of the Lorenz curve?The income distribution of a nation is depicted by the Lorenz curve. The vertical axis displays the percentage of the national revenue that each group receives, while the horizontal axis measures the population percentages. The diagonal line at a 45-degree angle cannot be above the Lorenz curve. This would imply that the bottom x% of earners make more money than the bottom x% of earners overall. This is not feasible because they could never earn more than x% of the total income and yet fall among the bottom x% of earners. The Lorenz curve would be a 45° line if the incomes of all households were equal. In general, the Lorenz curve will be nearer to the 45° line the more evenly money is distributed. more curved outwardly.

To learn more about Lorenz curve refer to:

https://brainly.com/question/29845210

#SPJ4

the _____ is the combination of advertising, personal selling, sales promotion, and public relations used to promote a product.

Answers

The Marketing Communications Mix is the specific mix of advertising, personal selling, sales promotion, and  public relations used to promote a product.

What does Marketing Communication Mix mean?

The term "marketing communication mix" refers to the various methods used by businesses to communicate with their target audiences. Advertising, public relations, direct marketing, personal selling, sales promotion, and digital marketing are all part of the communication mix. Each of these channels is used to reach out to a specific audience and convey a specific message. The communication mix's goal is to create a unified strategy that effectively reaches the target market while maximizing the return on investment.

What does Direct marketing mean?

Direct marketing is a type of promotion in which information about products or services is presented directly to the consumer without the use of an intermediary such as a retail store or a television or radio advertisement. Direct mail, telemarketing, and email marketing are all part of it.

To know more about  Direct marketing,

https://brainly.com/question/28285493

#SPJ1

• Vitamins B and C are found in two different foods F1 and F2. One unit of food F1 contains 2 units of B and 3 units of vitamin C. one unit of food F2 contains 4 units of B and 2 units of vitamin C. one unit of food F1 and F2 costs $3 and $2.5 respectively. • The minimum daily requirement (for a person) of vitamin B and C is 40 and 50 units respectively. Assuming that anything in excess of daily minimum requirement of vitamin B and C is not harmful. ● Find out the optional mixture of food F1 and F2at the minimum cost which meets the daily minimum requirement of vitamins B and C. Formulate this as a linear programing problem.​

Answers

Using linear programming, the optional mixture at minimum cost is x,y ≥ 0

What is Optional Mixture at Minimum Cost

Optional mixture at minimum cost is a process of combining a variety of materials, such as concrete, sand, gravel, and other aggregates, in order to create a mixture that is more cost-effective than buying the individual components separately. This type of mixture can be used in construction projects, road paving, and landscaping projects in order to save money.

Solving this mathematically with linear programming;

Let x be the number of units of food F1 and y be the number of units of food F2.

Minimize cost: z = 3x+2.5y

Subject to:

2x + 4y ≥ 40 (minimum requirement of vitamin B)

3x + 2y ≥ 50 (minimum requirement of vitamin C)

x,y ≥ 0 (non-negative constraint)

The linear programing problem is:

Minimize z = 3x+2.5y

Subject to:

2x + 4y ≥ 40

3x + 2y ≥ 50

x,y ≥ 0

Learn more on linear programming here;

https://brainly.com/question/13154906

#SPJ1

the shows the assets, liabilities, and owners' equity of a firm, at a specific point in time.

Answers

The balance sheets display a company's assets, liabilities, and owner's equity at a particular time.

what is a balance sheet?

A balance sheet is a financial statement that lists the assets, liabilities, and shareholder equity of a corporation at a certain point in time. Balance sheets serve as the foundation for calculating investor return rates and assessing a company's financial structure.

The balance sheet, or statement of financial position, is a summary of the assets and liabilities of a corporation as well as the amount of shareholder investment. To do fundamental analysis or determine financial ratios, balance sheets can be utilized alongside other significant financial accounts.

Learn more about balance sheets, from:

brainly.com/question/26323001

#SPJ1

Your question is incomplete, probably the complete question is-

The _____ shows the assets, liabilities, and owners' equity of a firm, at a specific point in time.

Answer:

balance sheet

Explanation:

g by how much will don's agi increase due to his partnership activities? assume he has no other capital gains or losses. note: qbi is deducted after agi and before taxable income.

Answers

A tax break known as the qualified business income deduction (QBI) enables qualified small-business owners and self-employed individuals to deduct up to 20% of their qualifying business income from their taxable income.

How is Qbi determined for a partnership?

50% of the company's W-2 wages OR the total of 2.5% of the unadjusted basis of all qualifying property + 25% of the company's W-2 wages. Whichever of these two wage tests results in a bigger deduction is your choice.

Qbid: How is it determined?

25% of the W-2 wages paid by the trade or business plus 2.5% of the unadjusted basis of the qualified property used by the trade or business, or 50% of the W-2 wages paid by the trade or business to create the QBI, whichever is larger.

To know more about taxable income visit:-

https://brainly.com/question/17961582

#SPJ4

a researcher studying small town religiosity in the united states randomly selected 10 states. from these states, he randomly selected one tenth of all counties. from these counties, he randomly selected one tenth of cities with populations smaller than 10,000. from these towns, he obtained lists of all houses of worship and randomly selected three. from these, he selected ten practitioners to be interviewed. in this example, states and counties are examples of _____.

Answers

In this example, states and counties are examples of CLUSTERS.

WHAT IS CLUSTER SAMPLING?

Researchers divide a population into clusters, or discrete groupings, during cluster sampling. To create a sample, they then randomly choose individuals from these clusters.

Large populations, especially those that are widely geographically distributed, are frequently studied using cluster sampling, a probability sampling technique. The pre-existing units that researchers typically utilize as their clusters are cities or schools.

The benefits of cluster sampling:

1.It is the most cost- and time-effective probability design for broad geographic areas.

2.From a practical standpoint, this strategy is simple to apply.

3.Due to the improved accessibility of prospective sample group members, a larger sample size can be utilized.

To know more about cluster sampling visit:

https://brainly.com/question/24317746

#SPJ4

Other Questions
a client with hypertension receives a prescription for carteolol (cartel) 7.5mg po daily. the drug is available in 2.5 mg tablets. how many tablets should the nurse administer? the third level of appeal is established when at least remains in controversy following a qualified independent contractor (qic. decision. a request for reconsideration through an administrative law judge (alj. hearing must be filed within 60 days of receipt of the reconsideration decision. Which of the following monetary and fiscal policy combinations would definitely cause a decrease in aggregate demand in the short run Ron is a junior web developer working on a web site that will function as the primary public facing site of a video game development company called Amazing Games Inc. Ron's immediate, superior (Lucy) has asked Ron to prepare a development server on a cloud provider to serve as a staging server where Ron can verify his site functions properly prior to moving it to the live production server. After 2 weeks of working on a portion of the site on the development server, Ron finishes up the pages that he has been working on. Everything works fine. When he moves the site to the production server, none of the images or CSS files work properly. The images appear as broken links. What is the most likely cause for the problem? O Ron used image types that are not compatible with the staging server but are compatible with the deployment server O Ron used images type that are compatible with the staging server but not compatible with the deployment server O Ron modified the host file on the development server to redirect DNS on the development computer and did not do so on the deployment server O Ron used absolute pathing to reference the files on the development server One important reason controls are useful to organizations is so that decision-making power can be centralized to a few key leaders.True or False A man is in a boat 2 miles from the nearest point on the coast. He is to go to point Q, located 3 miles down the coast and 1 mile inland (see figure). He can row at a rate of 1 mile per hour and walk at 3 miles per hour. Toward what point on the coast should he row in order to reach point Q in the least time? (Round your answer to two decimal places.) 0.84 mile(s) down the coast Which of the following shows that polynomials are closed under addition when two polynomials 4x2 - 8x - 7 and -5x + 16 are added? 7 need help A reflection maps AABC onto AXYZ. List the corresponding congruent pairs of angles of the two triangles. To join a health club, a person must pay a $75 one-time fee plus a charge of $30 per month. This situation can be represented by an equation of the form y=mx+b , where x = the time in months and y = the total cost in dollars. What is the value of m in the equation? rue or false: it is accurate to think of a fixed exchange rate as a simultaneous price ceiling and price floor. many people who fight against legalizing euthanasia say that it could create an issue in society where we condone the killing of those who are not ready to die, creating a The pattern of movement or cadence in your voice when you speak is which aspect of vocal delivery? An annual pass to the local zoo is$40.00. The daily pass is $12.00.What is the least number of timesyou can visit the zoo with theannual pass to make it the betterdeal? as a manager, how would you prefer a nonofficial leader respond to a challenge in rolling out a collaboration tool? umama wants to enable user experience virtualization (ue-v) by configuring group policy settings. two important settings that she needs to configure are the setting storage location and settings template catalog location. which of the following is true of this scenario? Question (Leo has an allowance of $80 from doing chores. He puts $22 into hissavings account. Leo plans to buy 4 new shirts this month. How muchmoney can Leo spend on each shirt?) the first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation and have the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin? how hard students work can depend on their expectations of what they can accomplish. the expectations of their teachers. all answer choices are correct. the expectations of their parents. Quotes should take up no more than ___ percent of your paper.OA. 80OB. 25O C. 10O D. 50 One angle measures 170, and another angle measures (6k 44). if the angles are vertical angles, determine the value of k. k = 12 k = 20 k = 21 k = 126