Solve the following inequality

Solve The Following Inequality

Answers

Answer 1

Hope that help, feel free to ask or comment.

Solve The Following Inequality

Related Questions

Write the equation for the line through the given point with the given slope. Write equations in slope intercept from.
(-2,-7); m=-3/2

Answers

The equation for the line through the given point with the given slope is y = -3/2x - 10.

What is slope ?

A line's steepness and direction are measured by the line's slope. Without actually using a compass, determining the slope of lines in a coordinate plane can assist in forecasting whether the lines are parallel, perpendicular, or none at all.

Any two different points on a line may be used to compute the slope of any line. The ratio of "vertical change" to "horizontal change" between two different locations on a line is calculated using the slope of a line formula. We shall comprehend the slope-finding method and its applications in this essay.

Through (-2,-7), slope=-3/2

m = -3/2

y = mx + b

-7 = -3/2 (-2) + b

3 - 8 = b

Switch sides

[tex]-\frac{3}{2}(-2)+b=-7[/tex]

Apply rule -(-a)=a

[tex]\frac{3}{2} \times 2+b=-7[/tex]

3+b=-7

Move 3 to the right side

b=-10

y = mx + b

y = -3/2x - 10

To learn more about slope visit:https://brainly.com/question/3605446

#SPJ1

The half-life of a substance is how long it takes for half of the substahce to decay or become
harmless (for certain radioactive materials). The half-life of a substance is 235 years, and there is anamount equal to 100 grams now. This function can be modeled by the expression A(t) = 100(0.5)
t/235

Part A: Discuss collaboratively: How can the expression for the amount, A(t), that remains after t
years, be rewritten using a base of 2 instead of a base of 0.5? Explain.

Part B: Using either one of the exponential models, what is the amount of substance remaining
(rounded to the nearest tenth) after 1,000 years?
I

Answers

a) Using a base 2, the exponential function can be written as follows:

A(t) = 100(2)^(-t/235)

b) The amount of substance remaining after 1000 years is given as follows: 5.2 grams.

What is the exponential function?

The exponential function for this problem is defined as follows:

A(t) = 100(0.5)^(t/235).

Which gives the amount of a substance after t years, considering a half life of 235 years.

The base can be changed to 2 as follows:

A(t) = 100(2)^(-t/235).

As exchanging the sign of the exponent, the numerator and the denominator of the base are exchanged, and 0.5 = 1/2.

The amount of the substance after 1000 years is calculated as follows:

A(1000) = 100 x (0.5)^(1000/235) = 5.2 grams.

More can be learned about exponential functions at https://brainly.com/question/25537936

#SPJ1

HELPPPPP ME NOW PLEASE
Write y=1/8x+7 in standard form unsung integers.
A. 8x-y=56
B. -x+8y=56
C. -x-8y=56
D. -x+8y=56

Answers

Answer:

-x + 8y = 56

Step-by-step explanation:

.................

Find the perimeter and total area of the composite shape shown below. All measurements are given in inches. Use = 3.14 in
any formulas used.

Answers

The area of the composite shape is 292.96 in² and the perimeter of the composite shape is 65.12 inches

Area of Half circle:

The quantity of surface contained within a semicircle's perimeter is known to as its area.

The formula for the Area of a half circle with a Radius (r) is given by  

            Area of Half circle = πr²/2

The formula for the perimeter of a half circle with a radius (r) is given by

           Perimeter of Half circle = πr

Here we have

A picture of a Rectangle with a half circle

Dimensions of Rectangle = 16 in × 12 in

=> Area of rectangle = 16 in × 12 in = 192 in²

=> Perimeter of rectangle shape = 12 + 16 + 12 = 40 inches

[ Here we only take one side of the rectangle since one of the sides is connected with a Half circle ]

The radius of half circle = 8 inch

=> Area of Half circle = π(8)² = (3.14)(64)/2 = 100.96 in²

=> Perimeter of Half circle = πr =(3.14)(8) = 25.12 in

Area of the composite shape

= Ractangle's Area + Half circle's Area

= 192 in² + 100.96 in²

= 292.96 in²

The perimeter of the composite shape

= Ractangle perimeter + Half circle perimeter

= 40 inches + 25.12 inches

= 65.12 inches

Therefore,

The area of the composite shape is 292.96 in² and the perimeter of the composite shape is 65.12 inches

Learn more about Half circles at

https://brainly.com/question/23157566

#SPJ1

help me pleasee asappp

Answers

The median of the data sets 10, 11, 13, 18, 19, 21, 22, 25, 27, 30, 32 is 21.

How to find median?

The Median is the "middle" of a sorted list of numbers. In other words, Median, in statistics, is the middle value of the given list of data when arranged in an order.

Therefore, let's find the median of the data sets.

Firstly, we have to sort the data in ascending order before we can find the median in the data set.

10, 11, 13, 18, 19, 21, 22, 25, 27, 30, 32

Hence, the sorted data set is 10, 11, 13, 18, 19, 21, 22, 25, 27, 30, 32.

Therefore,

median = 21

learn more on median here: https://brainly.com/question/29150855

#SPJ1

find the least commmon multiple (LCM) for each pair of numbers.To solve the riddle the letters to the numberd lines below 2,5 3,15 6,12 2,15 2,3 8,24 4,10 6,9 7,9

Answers

The LCM of the given pairs are 10, 15,12,30,6,24,20,18, and 63 respectively.

What is LCM?

The least common multiple (LCM) of two numbers is the lowest possible number that can be divisible by both numbers.

There are 9 pairs, so let's name them using the letters A to I.

The LCM of the first pair A (2, 5) is 10.

The LCM of the pair B (3, 15) is 1*3*5 = 15.

The LCM of the pair C (6, 12) is 3*2*1*2 = 12.

The LCM of the pair D (3, 15) is 2*3*1*5 = 30.

The LCM of the pair E (2, 3) is 1*3*2 = 6.

The LCM of the pair F (8, 24) is 2*2*2*1*3 = 24.

The LCM of the pair G (4, 10) is 2*2*5 = 20.

The LCM of the pair H (6, 9) is 3*2*3 = 18.

The LCM of the pair I (7, 9) is 7*9 = 63.

Hence, 10,15,12,30,6,24,20,18,63 are the LCM of the given pairs.

To learn more about LCM, use the link given below:

https://brainly.com/question/20739723

#SPJ1

a pizza parlor offers six toppings. what is the greatest number of four-topping pizzas that can be made such that no two pizzas have the same topping combination? (all four toppings must be different.)

Answers

On solving the provided question, we can say that - there are 120 distinct pizza topping combinations that may be created if the maximum number of toppings is 3.

What is combination?

Regardless of the sequence in which the items were chosen, a mathematical approach known as a combination may be used to calculate the number of alternative arrangements within a collection of objects. Any order can be chosen by a combination. Combinations in mathematics are ways to choose elements from a collection, and the order in which they are chosen is irrelevant. Let's say we have a trio of numbers: P, Q, and R. The amount of possible combinations for two integers from each set is determined by combinations.

Given: Six toppings in all.

There are three toppings to choose from.

Additionally, if topping repetition is prohibited, the number of viable combinations is equal to 6 × 5 x 4. [We select one out of six first, then one out of the remaining five, then one out of four, and finally we multiply the options for three toppings]

= 120

As a result, there are 120 distinct pizza topping combinations that may be created if the maximum number of toppings is 3.

To know more about combinations visit:

https://brainly.com/question/19692242

#SPJ4

James has $2,000 saved for a vacation his airplane ticket cost 637 his hotel costs 175 per night how many full night can he stay on vacation without going over his savings

Answers

He can spend $2000 on a 7-day vacation without going over his budget.

What is equation?

In its most basic form, an equation is a mathematical statement that indicates that two mathematical expressions are equal. 3x + 5 = 14, for example, is an equation in which 3x + 5 and 14 are two expressions separated by a 'equal' sign. A mathematical statement made up of two expressions joined by an equal sign is known as an equation. 3x - 5 = 16 is an example of an equation. We get the value of the variable x as x = 7 after solving this equation.

Here,

175x+637=2000

175x=1363

x=7.78

x=7.8

He can stay on vacation for 7 days with $2000 without going over his savings.

To know more about equation,

https://brainly.com/question/2228446

#SPJ1

give a point estimate (mean) for the average height of all people at the place where you work. start by putting the 20 heights you are working with into the blue data column of the spreadsheet. what is your point estimate, and what does this mean?

Answers

A point estimate (mean) for the average height of all people at the place where you work is 62.26

Mean is the average of the given numbers and is calculated by dividing the sum of given numbers by the total number of numbers.

In statistics, the mean is one of the measures of central tendency, apart from the mode and median. Mean is nothing but the average of the given set of values. It denotes the equal distribution of values for a given data set.

Given,

Number of observations =  20

Mean = sum of all observation / number of observations

Mean =  66 +65 +66+ 67+ 62+ 70+ 69+ 68+ 71+ 78+ 61+ 62.5+ 64+ 64.2+ 64.3+ 58+ 60+ 63+ 65+ 66.2 / 20

Mean = 1245.2 / 20 = 62.26

To know more about the mean visit: brainly.com/question/3116920

#SPJ4

what is the value of the expression 3^{2}*(2^{3} +4)-22

Answers

Answer:

86

Explanation:

3² × (2³ + 4) - 22

9 × (8 + 4) - 22

9 × 12 - 22

108 - 22

86

3. Solve the
proportion

x : 15 = 29 : 9.6

Answers

The required value of x for the given proportion is 45.31

What is proportion?

Proportion is a mathematical relationship or ratio between two or more values. It is used to compare the size, quantity, or degree of two or more objects or measurements. Proportion can be expressed as a fraction, decimal, or percentage. It is often used in geometry, algebra, and calculus to determine the size of a shape or to solve an equation. Proportion is also used in statistics to compare data sets. In everyday life, proportion is used to make sure that items are in good balance with each other. For instance, proportions are used when baking a cake or making a recipe to ensure that the ingredients are properly combined.

Given, the proportion

x : 15 = 29 : 9.6

or, x = [tex]\frac{29}{9.6}[/tex] × 15

or, x = 45.31

Hence, the required value of x for the given proportion is 45.31

To learn more about proportion

https://brainly.com/question/870035

#SPJ1

Seven days a year, Tiger Stadium becomes the fifth largest city in the state of Louisiana. Over 92,000 fans pack the stadium to watch the Tigers play. After the game, if the fans leave at a rate of 10% per minute, how long will it take before the stadium is half empty?

Answers

It will take 5 minutes before the stadium is half empty

How to determine how long will it take before the stadium is half empty?

Given that:

Over 92,000 fans pack the stadium to watch the Tigers play

The fans leave at a rate of 10% per minute

The number of fans that leave per minute will be:

10% of  92,000 = 10/100 × 92, 000 = 9,200

The stadium will be fully empty  in:

time = 92,000/9,200 = 10 minutes

The stadium will be half empty  in:

time = 10 minutes / 2 = 5 minutes

Learn more about rate and time on:

https://brainly.com/question/17146782

#SPJ1

 

Write an equation of the line that passes through the points.
4.(-3,0), (-2, 3)
5. (-6, 10), (6, -10)

Answers

4.

find slope;

3 - 0/-2 -(-3) = 3/1 = 3

y = 3x + b

0 = (3)(-3) + b

0 = -9 + b

b = 9

y = 3x + 9

12. What is the maximum value of a periodic
function with amplitude 6.5 and minimum
value 7?

Answers

The maximum value of the periodic function with amplitude 6.5 and minimum value 7 is 13.5.

What is a periodic function?

The time interval between two waves is known as a Period whereas a function that repeats its values at regular intervals or periods is known as a Periodic Function.

The maximum value of a periodic function with amplitude 6.5 and minimum value 7 is equal to the sum of the amplitude and the minimum value.

The amplitude of a periodic function is defined as the maximum distance that the function deviates from its centerline. In this case, the amplitude of the function is 6.5.

The minimum value of a function is the lowest value that the function takes on over a given period. In this case, the minimum value of the function is 7.

To find the maximum value of the function, we need to add the amplitude and the minimum value. The maximum value is equal to 6.5 + 7 = 13.5.

Hence, the maximum value of the periodic function with amplitude 6.5 and minimum value 7 is 13.5.

To learn more about the periodic function, visit:

https://brainly.com/question/2490759

#SPJ1

the sum of the sequence 7+21+63..... to the 9th term

Answers

68,887 is the sum of the sequence (7+21+63...) to the 9th term.

That is, the sequence (as far as we are given) has a common ratio r=3, between successive terms. The initial term  a= 7 and we are interested in the sum to N = 9 terms.

and the sum of the 9th term is

[a^n = a( 1 - r^N)/1 - r ]

=[7 ( 1 - 3^9 )/ 1 - 3 ]

=7 ( 1 - 19683) / -2

= - 137,774 / -2

= 68,887

9th term = 68,887

To know more about the sequence

https://brainly.com/question/21961097

Tabatha and Horatio each leave their separate houses and drive to a restaurant to meet for dinner. Tabatha lives 15 miles from the restaurant, and she drives at a rate of 3 miles every 2 minutes. The graph represents Horatio’s distance, in miles, y, from the restaurant after driving for x minutes.
Tabatha drives 1/12 mile more per minute than Horatio drives.
Tabatha drives 1/6 mile more per minute than Horatio drives
Tabatha drives 3 miles more per minute than Horatio drives.
Tabatha drives 9 miles more per minute than Horatio drives.

Answers

Answer:

Tabatha drives 1/6 mile more per minute than Horatio drives

Step-by-step explanation:

Given the equation 7m − 11 = 5m + 43 and the possible solution set S: {2, 27, 54, 86}:

Part A: Determine which integer(s) in the solution set makes the equation false. Show all work. (8 points)

Part B: Use a complete sentence to explain how you were able to determine which values make the equation false. (4 points)

Answers

A) The integers that make the equation false are {2, 54, 86}

B) We found that by solving the linear equation.

Which integer makes the equation false?

Here we have the following linear equation:

7m - 11 = 5m + 43

And the set of the possible solutions is S: {2, 27, 54, 86}

The simplest way to see which integer makes the equation false, we just need to replace the values of the possible solution sets and see which ones give a false equation.

Another method is to simplify the equation, and i will do that:

7m - 11 = 5m + 43

7m - 5m = 43 + 11

2m = 54

m = 54/2

m = 27

So the equation has a single solution, m = 27.

Then the integers that make the equation false are {2, 54, 86}

B) We determined the only true solution for the linear equation, and thus, all the other possible integers aren't solutions, thus, make the equation false.

Learn more about linear equations:

https://brainly.com/question/1884491

#SPJ1

does anyone know what -x/3 ≥ 15 is?

Answers

After solving the given inequality, the obtained value will be x ≤ -45.

What is inequality?

Inequalities are mathematical expressions where neither side is equal. In inequality, as opposed to equations, we compare the two values. Less than (or less than and equal to), larger than (or greater or equal to), or not similar to signs are used in place of the equal sign in between.

As per the given inequality in the question,

-x/3 ≥ 15

-x ≥ 45

Multiply the equation with a minus sign, due to which the sign of inequality will change.

So, the inequality will be,

x ≤ -45

To know more about Inequality:

https://brainly.com/question/28823603

#SPJ1

An online furniture store sells chairs for $100 each and tables for $400 each. Every
day, the store can ship no more than 18 pieces of furniture and must sell no less than
$2900 worth of chairs and tables. Also, the store must sell a minimum of 10 tables. If
a represents the number of tables sold and y represents the number of chairs sold,
write and solve a system of inequalities graphically and determine one possible
solution.

PLS INCLUDE THE INEQUALITIES

Answers

y ≥ 0 , Zero possible solution.

What is inequality ?

In mathematics, an inequality represents the connection between two values in an imbalanced algebraic statement. A sign of inequality can be used to show that one of the two variables is larger than, greater than or equal to, less than, or equal to another value.

According to question

a represents the number of tables sold and y represents the number of chairs sold

Using a and y as variables, we get

a + y ≤ 18

100y + 400a ≥ 2900

Simplified,

100(y + 4a) ≥ 2900

y + 4a ≤ 29

Given the minimum number of tables that need to be sold, we evaluate using a = 10

y + 4(10) ≥ 29

y ≥ -11

y represents the number of chairs sold

therefore, y ≥ 0

Since we can't purchase -11  chair, we round up our result giving us y ≥ 0

Now

the store must sell a minimum of 10 tables and tables for $400 each

then

10*400 = $4000

which is more than worth of chairs and tables $2900

hence Zero possible solution.

To learn more about Inequality , check out

https://brainly.com/question/28823603

#SPJ1

2. Quadrilateral QRTUhas vertices Q(-5, 6), R(6, 4).
7(3, -7), and (/(-2,-2).
Part A
What are the endpoints of Q'U' if the preimage is
reflected across the j-axis?
Q'L
) and
U'(______________
Part B
What are the coordinates of R' if the preimage is
translated by vector (-6, 2)?
R'(
Part C
What are the coordinates of T' if the preimage is
rotated 90° clockwise about the origin?
T’

Answers

a) The endpoints of Q'U' is the preimage is reflected across the y-axis is given as follows: Q'(5,6), U'(2,-2).

b) The coordinates of R' if the preimage is translated by the vector (-6,2) are given as follows: (0,6).

c) The coordinates of T if the preimage is rotated 90º clockwise about the origin are given as follows: (7,3).

What are the transformations?

The rule for a reflection across the y-axis is given as follows:

(x,y) -> (-x,y).

Which was used to obtain the vertices in item a, exchanged the signal of the x-coordinate while keeping the y-coordinate constant.

The rule for a translation by the vector (-6,2) is given as follows:

(x,y) -> (x - 6, y + 2).

Which was used for vertex R in item b.

The rule for a 90º clockwise rotation about the origin is of:

(x,y) -> (-y,x).

Used in item c.

More can be learned about transformations at https://brainly.com/question/29209050

#SPJ1

Find the slope passing through the point -8,-4 and 3,-4

Answers

Answer:

0

Step-by-step explanation:

(-8, -4) and (3, -4)

m = y2-y1 / x2-x1

m = -4+4 / 3+8

m = 0 / 11

m = 0

May I please have a brainliest for this? Thank you!

two thirds of a number b is no more than 12.

Answers

two thirds of a number b which is no more than 12, is b ≤ 18

What is inequality ?

In mathematics, an inequality represents the connection between two values in an imbalanced algebraic statement. A sign of inequality can be used to show that one of the two variables is larger than, greater than or equal to, less than, or equal to another value.

According to question

two thirds of a number b = (2/3)b

Given two thirds of number b is no more than 12

⇒   (2/3)b ≤ 12

⇒   2b ≤ 12*3

⇒   b ≤ (12*3)/2

⇒   b ≤ 36/2

⇒   b ≤ 18

hence the number b whose 2/3 is no more than 12 is, b ≤ 18

To learn more about Inequality , check out

https://brainly.com/question/28823603

#SPJ1

Given f(x) = x² - 1 and g(x) = x + 5, find h(x) = (f. g)(x).

Answers

The function h(x) = (f.g)(x) would be x² + 10x + 24.

What are composite functions?

A composite function is generally a function that is written inside another function. The composition of a function is done by substituting one function into another function. For example, f [g (x)] is the composite function of f (x) and g (x). The composite function f [g (x)] is read as “f of g of x”.

To find h(x) = (f.g)(x), we need to find the composition of the functions f(x) and g(x).

The composition of two functions f(x) and g(x) is denoted by (f.g)(x) and is defined as (f.g)(x) = f(g(x)).

In this case, we have:

h(x) = (f.g)(x) = f(g(x)) = f(x + 5)

Substituting x + 5 for g(x) in the equation for f(x), we get:

h(x) = (f.g)(x) = f(x + 5) = (x + 5)² - 1

Simplifying this expression, we get:

h(x) = (f.g)(x) = x² + 10x + 24

Hence, the function h(x) = (f.g)(x) would be x² + 10x + 24.

To learn more about the composite functions, visit:

https://brainly.com/question/10687170

#SPJ1

2. How many points of inflection will f(x) = 3x5+2x4 - 5x - 12 have?
5
3
2
4

Answers

2 points of inflection will f(x) = 3x5+2x4 - 5x - 12 have.

What is Inflection points definition?

An inflection point is a point on the graph at which the second derivative is equal to zero or undefined and changes sign.

The characteristic that every input is associated to exactly one output defines a function as a relationship between a set of inputs and a set of allowable outputs. A mapping from A to B will only be a function if every element in set A has one end and only one image in set B. Let A & B be any two non-empty sets.

If [tex]$f^{\prime \prime}(x) > 0$[/tex]then f(x) concave upwards.

If [tex]$f^{\prime \prime}(x) < 0$[/tex]then f(x) concave downwards.

[tex]$$f^{\prime \prime}(x)=126 x^5+40 x^3$$[/tex]

Show Steps

Find intervals: Concave Downward: [tex]-\infty < x < 0$, Concave Upward: $0 < x < \infty$[/tex]

Plug x=0 into [tex]$3 x^7+2 x^5-5 x-12: \quad-12$[/tex]

(0,-12)

To learn more about inflection point visit:https://brainly.com/question/29017999

#SPJ1

what is r 156 ÷ r = 26

Answers

Answer:

r=6

Step-by-step explanation:

156/r=26

All terms are shifted to the left:

156/r-(26)=0

We divide every term by the denominator.

-26*r+156=0

All the numbers and variables are added together.

-26r+156=0

All terms containing r are shifted to the left, and all other terms are shifted to the right.

-26r=-156

r=-156/-26

r=6

Heather, Kareem, and Chris served a total of 81 orders Monday at the school cafeteria, Chris served 2 times as many orders
as Heather, Kareem served 5 more orders than Heather How many orders did they each serve?

Answers

Answer: Heather served 15 orders, Kareem served 20 orders, and Chris served 30 orders.

Step-by-step explanation: Let H be the number of orders that Heather served, K be the number of orders that Kareem served, and C be the number of orders that Chris served.

We are given that C = 2*H and K = H + 5.

We are also given that H + K + C = 81.

Substituting the expressions for C and K into the equation, we get:

H + (H + 5) + (2*H) = 81

5*H + 5 = 81

5*H = 76

H = 15

Since Heather served 15 orders, Kareem served 15 + 5 = 20 orders and Chris served 2*15 = 30 orders.

Therefore, Heather served 15 orders, Kareem served 20 orders, and Chris served 30 orders.

an item is regularly priced at . it is on sale for off the regular price. how much (in dollars) is discounted from the regular price?

Answers

An item is regularly priced at, 1.98$ is discounted from the regular price.

A percentage is a portion of a whole expressed as a number between 0 and 100 rather than as a fraction. All of something is 100 percent, half of it is fifty percent, none of something is zero percent. To determine a percentage, you divide the portion of the whole by the whole itself and multiply by 100.

Given that,

First, change the percentage into decimal:

Let us assume,

Sale of regular price = 1%

1% = 1/100 = 0.01

Assume, item regular price is = 2$

Multiply 2 with 0.01:

2 * 0.01 = 0.02

Note that this number 0.02 (0.01 of 2) is the amount off from the original price (2). Subtract 2 from 0.02

2 - 0.02 = 1.98

Therefore,

An item is regularly priced at, 1.98$ is discounted from the regular price.

To learn more about Regular price problems visit :

brainly.com/question/11848736

#SPJ4

The table shows the scores of two teams at the end of the first half of a trivia challenge.



Team Points Scored
Bobcats 2x−7
Huskies 5x−3


How many more points did the Huskies score than the Bobcats?

Answers

The point difference between Huskies and Bobcats are 3 x + 4.

What is algebra ?The area of mathematics known as algebra is used to portray situations or problems using mathematical expressions. In algebra, we utilize integers with fixed or definite values, such as 2, 7, 0.068, etc. In algebra, we combine integers with variables like x, y, and z.One-step equations can be solved in four different ways: by adding, subtracting, multiplying, and dividing. In an equation, both sides will stay equal if we add the same amount to either side.The sequence in which you perform operations in arithmetic and algebra is governed by a number of rules. The Commutative, Associative, and Distributive Laws are the three that receive the most attention.

Given data :

Difference = Huskies - Bobcats

Hence,

( 5x - 3 ) - ( 2x - 7 )

= 5x - 3 - 2x + 7

= 3x + 4

Learn more about algebra refer to :

https://brainly.com/question/22399890

#SPJ1

∠A and \angle B∠B are complementary angles. If \text{m}\angle A=(2x-13)^{\circ}m∠A=(2x−13)

and \text{m}\angle B=(2x+7)^{\circ}m∠B=(2x+7)

, then find the measure of \angle A∠A.

Answers

The measure of ∠A is 29.

What is an angle?

An angle is a figure in plane geometry that is created by two rays or lines that have a shared endpoint. The Latin word "angulus," which meaning "corner," is the source of the English term "angle." The shared terminus of two rays is known as the vertex, and the two rays are referred to as sides of an angle.

Given that,

m∠A = (2x−13)° and m∠B = (2x+ 7)° and ∠A and ∠B are complementary angles.

Therefore

m∠A + m∠B = 90°

(2x−13)° + (2x+ 7)° = 90°

4x + 6 =90

Subtract 6 from both sides:

4x = 84

Divide both sides by 4:

x = 21

Putting x = 21 in m∠A = (2x−13)°:

m∠A = (2 × 21−13)°

m∠A = 29°

To learn more about complementary angles, click on below link:

https://brainly.com/question/18589026

#SPJ1

If Winston left a 15 percent tip on his orders every day, how much money in tips alone did he leave in total on Monday, Tuesday, and Wednesday?

Answers

The total amount that will be paid of there's a 15% tip is $57.50.

How to calculate the percentage?

A percentage is a value or ratio that may be stated as a fraction of 100. If we need to calculate a percentage of a number, we should divide it's entirety and then multiply it by 100. The percentage therefore refers to a component per hundred. Per 100 is what the word percent means. It is represented by %.

Let's assume that the cost of the good bought is $50. A 15% tip will give a value of:

= 15% × $50

= $7.50

The total amount to be paid will be:

= $50 + $7.50

= $57.50

Note that an overview was given as the information is incomplete.

Learn more about percentages on:

brainly.com/question/24877689

#SPJ1

Other Questions
To join a health club, a person must pay a $75 one-time fee plus a charge of $30 per month. This situation can be represented by an equation of the form y=mx+b , where x = the time in months and y = the total cost in dollars. What is the value of m in the equation? rue or false: it is accurate to think of a fixed exchange rate as a simultaneous price ceiling and price floor. many people who fight against legalizing euthanasia say that it could create an issue in society where we condone the killing of those who are not ready to die, creating a a nurse is teaching the staff about the benefits of nursing outcomes classification. which information should the nurse include in the teaching session? (select all that apply.) The pattern of movement or cadence in your voice when you speak is which aspect of vocal delivery? An annual pass to the local zoo is$40.00. The daily pass is $12.00.What is the least number of timesyou can visit the zoo with theannual pass to make it the betterdeal? find the generating function for the number of ways to distribute blank scratch paper to alice, bob, carlos, and dave so that alice gets at least two sheets, bob gets at most three sheets, the number of sheets carlos receives is a multiple of three, and dave gets at least one sheet but no more than six sheets of scratch paper. without finding the power series expansion for this generating function (or using a computer algebra system!), determine the coefficients on and in this generating function. as a manager, how would you prefer a nonofficial leader respond to a challenge in rolling out a collaboration tool? umama wants to enable user experience virtualization (ue-v) by configuring group policy settings. two important settings that she needs to configure are the setting storage location and settings template catalog location. which of the following is true of this scenario? Question (Leo has an allowance of $80 from doing chores. He puts $22 into hissavings account. Leo plans to buy 4 new shirts this month. How muchmoney can Leo spend on each shirt?) 21. The book of Vedas that contained more than 1,000 hymns was called: the first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation and have the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin? how hard students work can depend on their expectations of what they can accomplish. the expectations of their teachers. all answer choices are correct. the expectations of their parents. Quotes should take up no more than ___ percent of your paper.OA. 80OB. 25O C. 10O D. 50 134. In radian mode, graph both y = sin-' x and y = I - sin' x on the same coordinate-axis system. What do you notice? One angle measures 170, and another angle measures (6k 44). if the angles are vertical angles, determine the value of k. k = 12 k = 20 k = 21 k = 126 the proper level of government intervention is unclear when dealing with a monopoly. group of answer choices true false Which of the following is a typical amount of petty cash a small business would want to keep on hand the anticodon of a particular trna molecule is the anticodon of a particular trna molecule is complementary to the corresponding mrna codon. complementary to the corresponding triplet in rrna. the part of trna that bonds to a specific amino acid. changeable, depending on the amino acid that attaches to the trna. catalytic, making the trna a ribozyme. sales were $70,000. cost of merchandise sold was 55% of sales. 65% of sales were on open account. [note: record the complete sales entry first, and the complete expense entry second.]