Which one has higher ecosystem diversity, rain forest or desert?

Answers

Answer 1

Answer:  The Rain forest


Related Questions

List the order in which Consumers arrive to your new ecosystem

Answers

Answer:

Producers, Primary consumers, Secondary Consumers, and Tertiary Consumers.

Explanation:

Why are offshore wind farms more suitable than those situated on land?
O A. The oceans offer more open space to set up wind farms.
OB. The winds from the ocean are cooler than those blowing over land.
OC. Wind speeds over the ocean are higher than those over land.
D.
There is more wind over the oceans than there is over land.
E. Moisture-laden winds from the ocean are more suited than dry winds that blow over land.
Reset
Next​

Answers

Answer:

C

Explanation:

Google

PLZZZZZ HELPPP!!
Select the correct answer.
A force of 15 newtons is applied to both Object A with a mass of 25 kilograms and Object B with a mass of 50 kilograms. What is true about th
acceleration of Object A and Object B?
ОА
Acceleration of Object A is four times that of the acceleration of Object B.
OB.
Acceleration of Object A is the same as the acceleration of Object B.
Ос.
Acceleration of Object A is half the acceleration of Object B.
OD
Acceleration of Object A is twice that of the acceleration of Object B.

Answers

Answer:

B

Explanation:

i believe

Which of the following shows a reduction of chromosomes by half?

Answers

Answer:

"Sporophyte to spores"

Explanation:

"Sporophyte to spores" is the one among the following choices given in the question that shows a reduction of chromosomes by half. The correct option among all the options that are given in the question is the second option. I hope that this is the answer that has actually come to your desired help.

Which of the following is an indicator of chemical change?
a change in phase of the materials
a change in the shape of the materials
a change in the volume of the materials
a change in the temperature of the materials

Answers

Answer: a change in the temperature of the materials

Explanation:

Normal blood cells slide easily through narrow blood vessels. In sickle cell disease many red blood cells change to a crescent shape like a slender moon Crescent-shaped blood cells cause blockages in blood vessels These blockages decrease the transport of oxygen People with sickle cell disease often have sharp pains due to the lack of oxygen in parts of the body Some people have one sickle cell gene and one normal gene They have few defective cells and no symptoms because the sickle cell gene is recessive. How does the method of reproduction in humans result in people getting one copy of a sickle cell gene and one copy normal gene? Describe the process

Answers

Answer:

Explanation:

The method of reproduction in humans is sexual reproduction: a type of reproduction that occurs when new organisms are produced through the coming together of genetic information from two individuals of different sexes mostly a male and a female (egg cell and the sperm). The genetic information for making the blood cells; the red blood cells genes in particular exists on chromosomes in the nucleus of the sex cells (egg and sperm cell) also called the gametes. Basically, the DNA provides instructions for the production of mostly all of the body's needs.

The genes coding for the sickle cells which is the abnormal red cell is always inherited in the recessive form meaning both parent has to possess one copy each of the defective gene in their DNA. For humans to get one copy of a sickle cell gene and one copy normal gene; it means one of the parents gametes (be it male or female) contributed the defective chromosome and the other normal gene is contributed by the other parent  during copulation giving rise to an individual that is heterozygous for the trait

For example, the sperm cell with the defective gene fertilizes the egg cell that has the normal copy of the gene producing an heterozgous individual.

PLEASE HELP!! ASAP!! I WILL MARK YOU BRAINLIEST!!
All life on Earth depends on _____ for survival.
a
producers
b
the sun's energy
c
eating other organisms
d
chemosynthesis

Answers

Answer:

The suns energy

Explanation:

The answer is B the suns energy

Which arrow represents the change of state described
above?
The diagram shows changes of state between solid,
liquid, and gas. The atoms of a substance gain energy
during a change of state. Before the change, the atoms
are close together and cannot slide past one another.
After the change, the substance can fill its container.
L
м
N
O

Answers

Answer:

Solid

Explanation:

If the atoms are closer together, it's a solid. If they are far apart, it's a gas. If it's in between, it's a liquid.

Alternate forms of a gene having the same position on a pair of chromosomes and affecting the same trait
are called ______. A) phenotypes B) alleles
C) DNA
D) mutations E) genotypes

Answers

Answer:

The answer is B) alleles

Explanation:

Alternate forms of a gene having the same position on a pair of chromosomes and affecting the same trait are called alleles.

What do you mean by traits?

Traits may be defined as the appearance or manifestation of the desired characters. Traits are also known as phenotypes.

Every factor or gene has two alternative copies, one comes from the father and one comes from the mother. These two copies are present in the same location on the homologous chromosome. They are known as alleles of each other.

Therefore, Alternate forms of a gene having the same position on a pair of chromosomes and affecting the same trait are called alleles.

To learn more about Alleles, refer to the link:

https://brainly.com/question/898077

what is the difference between a breed and a species?

Answers

Answer:

A breed is an artificially selected group of animals. A species is a naturally selected group of organisms.

Explanation:

Breed: A breed refers to a stock of animals within a particular species with distinctive characteristics, which is produced by selective breeding. Species: A species refers to a group of living organisms, which consist of similar characteristics and breed to produce a fertile offspring.

Which is a result of selective breeding?
a. Large seedless watermelons that consumer demand.
b. Oranges that are all different sizes and colors.
c. An insect that can carry ten times its body weight.
d. A bird that catch prey with its beak.

Answers

Answer:

a. Large seedless watermelons that consumer demand.

Explanation:

The Large watermelons are bred based on consumer demand.

A. Large seedless watermelons that consumer demand.

This is because many people don’t want seeds in their watermelon so they select the ones that don’t have as many seeds and then breed them and keep doing that and it leads to seedless over time.

Water as deep as ___ is still affected by the wind at the Earth’s surface
A) 60 m B) 250 C) 400 m D) 700 m

Answers

A) 60m

Wind can affect water up to 100m (325 feet) in depth.

Matter are anything that is made up of atoms. The quantity of matter can be observed only on the basis of mass and volume calculation. Therefore, the correct option is option A.

What is matter?

Matter is a substance that has some mass and can occupy some volume. The matter is mainly used in science. Matter can be solid, liquid or gas.

Matter is anything that is made up of atoms. Anything around us that can be physically seen and touched are matter. Ice, water and water vapors are example of matter.

So as we saw that matter has some mass so mass can be measured in gram only. Mass can also be represented as number of molecules. We also saw that matter occupy some volume and that volume is measured only in liter. Water as deep as 60 m is still affected by the wind at the earth’s surface.

Therefore, the correct option is option A.

To learn more about matter, here:

https://brainly.com/question/4562319

#SPJ2

(01.01 MC)

An idea is being proposed. The steps that led to the idea are listed below:

Only the favorable evidence were considered.
There was a review by the scientific community.
The outcomes were same each time.

Can this idea be scientific?

Yes, because the idea produced reliable results.
No, because it was not reviewed by family and friends.
Yes, because all steps of the scientific method were followed.
No, because conflicting evidence and arguments were not considered.

Answers

No, because conflicting evidence and arguments were not considered.

Give the person brainliest. i mean ik this was over a year ago but if u see dis, u can now give the person brainliest.

When iron in rocks reacts with oxygen, it
forms iron oxide (rust), which weakens
rocks and causes them to break apart.
This is an example of...

Answers

Answer:

Oxidation

Explanation:

An example of plasma is _____________liquid_______________________.

2. The fifth type of matter that can be created only in a laboratory is called ___condensate_________________.
are these correct?

Answers

Answer:

Example of plasma.

Explanation:

lightning.aurorae.the excited low-pressure gas inside neon signs and fluorescent lights.solar wind.welding arcs.the Earth's ionosphere.stars (including the Sun)the tail of a comet.

2.It's Bose-Einstein condensate, 

Which level of organization is shown in the diagram?

organ

tissue

organ system

cell

Answers

Cell-tissue-organ-organ system

Answer:

i believe this is the organ

Explanation:

the picture shown above is a kidney

kidney =organ or it is organized in the order

Cell-tissue-organ-organ system

Seth will attend college in the fall and live in the dormitory, so he is required to obtain a blank against bacterial meningitis, which will stimulate his body to produce immunity to the disease. He reads that meningitis is a fast-acting and potentially fatal disease, transmitted by blank in the respiratory droplets of infected individuals. The bacteria are blank that cause disease by destroying blank and releasing blank that disrupt the body’s normal homeostasis. Bacterial infections are treated with blank , which block the growth and reproduction of bacteria.


Key answer: bacteria, vaccine, cells, pathogens, toxins, antibiotics

Answers

Answer:

vaccine

bacteria

pathogens

cells

toxins

antibiotics

Explanation:

Bacterial meningitis is a serious disease that is caused by an infection which results into Inflammation of brain and spinal cord membranes.

It is generally caused by virus but also caused by fungus and bacteria. A vaccine is required to fight against the bacterial meningitis. Symptoms include fever, stiff neck and headache. This disease is carried by the bacteria present in the throat of infectious person and can transmit through coughing, sneezing and kissing. The bacteria are the pathogens, releases a toxin which destroy cells and surface components of nervous system.

This disease is treated with intravenous antibiotics and corticosteroids (sometimes).

Hence, the correct answers for blanks are vaccine, bacteria, pathogens, cells, toxins, and antibiotics in sequential order.

How are drug resistant strains of HIV Produced?

Answers

Answer:

If a strain of HIV is cloning itself and the patient is taking antiretroviral medication, the strain evolves around that and becomes immune to the medication. This happens a lot.

Explanation:

. HIV can mutate “around” that medication. This will result in HIV being resistant to the medications and those medications now being ineffective.

Jacque is hiking in the mountains and sees a very large and colorful rock layer. It looks different than the surrounding rock layers. What is the best way for Jacque to investigate what the environment was like when this rock layer was deposited?

Jacque could measure the height of the rock layer.

Jacque could check if the rock layer has fossils in it.

Jacque could look at the color of the surrounding rock layers.

Jacque could chip off a chunk of rock from the rock layer and smell it.

Answers

Answer:

Jacque could check if the rock layer has fossils in it.

Hope this helps and answers your question. Sorry if I'm wrong. Have a great day/night

Select the correct answer.
What term describes a species whose removal would affect many other species, both directly and indirectly
A. predator species
B. Keystone species
OC. cascading species
OD. phoresy species
Next​

Answers

Answer:

Keystone species

Explanation:

Keystone species is that species whose presence and number in the ecosystem plays an important role in balancing the ecosystem and without them, the other species would be affected directly and indirectly.

A dominant predator is considered to be a keystone species because the removal of that predator allow their prey to explode in numbers which will decrease the overall biodiversity of the area. Prairie dogs, otters, bison are the examples of keystone species. So the correct answer is B. Key stone species.

Compare and contrast pollution caused by irrigation and by pesticides.

Answers

Irrigation causes an increase in salt which will kill plants. Pesticides poison water making it undrinkable. Pesticides can contaminate the soil for long periods of time.

Pesticide pollution and irrigation pollution have different characteristics, but both have the potential to have negative effects on the ecosystem.

Here is a side-by-side comparison of the two:

Pesticide usage and irrigation both have the potential to contaminate water. Excessive irrigation can result in the contamination of nutrients in water bodies due to the leaching of pesticides and fertilisers.

Both pesticides and irrigation can have a negative impact on ecosystems. Excessive irrigation water use can harm aquatic habitats and deplete water supplies.

Pollution sources: Irrigation is a major cause of pollution due to the excessive water use and subsequent discharge of nutrients, silt, and fertilisers.

Pesticides, on the other hand, are chemical compounds created especially to manage pests and have the potential to pollute the environment directly through runoff, spray drift, or persistence in the soil.

Management and Regulation: Irrigation and pesticides are managed and regulated in different ways. Policies for managing water resources and conservation measures can be used to control irrigation practices.

Contrarily, the use of pesticides is subject to stricter laws and oversight to guarantee correct application, handling, and mitigation of side effects.

Thus, this is the comparison and difference between pollution caused by irrigation and by pesticides.

For more details regarding pesticides, visit:

https://brainly.com/question/30295459

#SPJ6

Identify the disorders described. immune system overreacts to an antigen part of the immune system does not function properly the body's immune system attacks its healthy cells, mistaking them for pathogens masses of cells form and steal nutrients from healthy cells

Answers

Answer: 1: allergic disorders

2. Immunodeficiency disorders

3. Autoimmune disorders

4. Cancers

Immune system overreacts to an antigen part of the immune system does not function properly the body's immune system attacks its healthy cells, mistaking them for pathogens masses of cells form and steal nutrients from healthy.

What do you mean by Allergy?

Allergy may be defined as a reaction by our immune system to something that does not trouble most other people. It affects a person more specifically.

When a person gets affected by any allergy, the immune system of that person may overreact by producing more antibodies. These antibodies attack the allergen particles and cause adverse symptoms.

A person who has allergies has them because his or her body over reacts to a material that would otherwise be ignored. It is an overreaction of the immune system triggering a immune attack response that is unneeded.

Therefore, a person who has allergies has a compromised immune system because the body's immune system overreacts to an antigen.

Learn more about antigen on:

https://brainly.com/question/19793069

#SPJ2

There are some animals, like bald eagles, that are opportunistic predators. They are as likely to catch a live fish as they are to eat a dead fish that has washed up on shore. True or False

Answers

Answer:

true

Explanation:

Bald Eagles are opportunistic predators, they steal food from other animals as well as hunt on their own.

Complete and analyze the Punnett square. R represents round seeds; r represents
wrinkled seeds.

Ratio of phenotypes:
Ratio of genotypes:
Percent of offspring with round seeds:
Percent of offspring with wrinkled seeds:


WILL MARK!!

Answers

Answer:

below

Explanation:

Genotype

RR-25%

Rr-50%

rr-25%

Phenotype

R-75%

r-25%

Percent of offspring with round seeds:75%

Percent of offspring with wrinkled seeds:25%

1pt Which of the following life processes is not necessary for an individual organism to survive, but is necessary for the survival of the species?
A. digestion
B. respiration
C. regulation
D. reproduction

Answers

Answer:

D. reproduction

Explanation:

If the species doesn't reproduce they die out or become extinct.

Local authorities need to be on the lookout to stop hazardous waste _____ who get around laws using tactics such as bribes, false permits, and mislabeling of hazardous wastes.
Group of answer choices

A.producers

B.manufacturers

C.emitters

D.users

E.smugglers

Answers

Answer:

A and B

Explanation:

The correct options to fill the gap would be A and B.

Wastes are generated mainly from production or manufacturing processes. Hence, those that can try to get around laws to indiscriminately pollute the environment would be producers or manufacturers of goods.

Therefore, the correct options are A and B.

Which scenario is an example of functional adaption?

Answers

Answer:

A functional adaptation is any adaptation that helps an organism survive. Hence, the correct answer is option D - the color and shape of a flounder allow it to camouflage.

Explanation:

What type of energy transformation takes place when carbon is cycled during cellular respiration?
A) Chemical energy to chemical energy
B) Chemical energy to electrical energy
C) Mechanical energy to chemical energy
D) Mechanical energy to mechanical energy

Answers

Answer:

C

Explanation:

A coal-fired power plant involves these energy transformations: Chemical energy in the coal is converted into thermal energy in the exhaust gases of combustion. Thermal energy of the exhaust gases converted into thermal energy of steam through heat exchange.


Which term describes the area of bedrock from which soil forms?

mineral deposit

B horizon

parent rock

A horizon

Answers

Answer:

A

Explanation:

Answer:

A. Horizon describes the area of bedrock from which soil forms.

hope it helps!

Where are seeds(plant EGGS) found?*
Anther
Ovary
Petal
Filament

Answers

Answer:

Ovary

Explanation:

ANSWER: Ovary

EXPLANATION: The ovary contains ovules (eggs) that become seeds once they are fertilized.
Other Questions
In a survey of students, 1162 stated they cheated and 2468 stated they did not. If one student is randomly selected what is the probability that they cheated PLZZZ HELP CHEM!!!!!!! Easy points!!!!! Dr. Barber needs to pay her employees $15.00 an hour. If she has fivetechnicians and they each worked 25 hours, how much money in total will Dr.Barber pay all of the technicians? What was president Franklin d Roosevelt greatest contribution while the nation recovered from an economic disater and faced another potential war in europe You have a standard deck of cards. The deck has 52 total cards and contains 4 suits: hearts, clubs, diamonds, and spades. Each suit consists of cards numbered 2-10, a jack, a queen, a king, and an ace.You select one card at random from the deck. Let A be the event that the randomly selected card is a diamond and let B be the event that the card is a king. Based on this information, answer the following questions. Which number line shows the solutions to n Help me please !!!!! if the 50 kg objects slows down to a velocity of 1 m/s how much kinetic energy does it have? Choose the option that best matches the description given.information assurance is a type of: 1.computer virus 2.cuber security 3.engineering Why did god give his people laws The equation of certain traveling waves is y(x.t) = 0.0450 sin(25.12x - 37.68t-0.523) where x and y are inmeters, and t in seconds. Determine the following:(a) Amplitude. (b) wave number (C) wavelength. (d) angular frequency. (e) frequency: (1) phase angle, (g) thewave propagation speed, (b) the expression for the medium's particles velocity as the waves pass by them, and (i)the velocity of a particle that is at x=3.50m from the origin at t=21.os If I add 50 mls of water to 300 mls of 0.6M KNO3 solution, what will be the molarity of the diluted solution? The changes in composition in an area over time is called What did LBJ decide to do in 1968? Mark wants a new car that costs $30000. He only has $500 in his savings account and $300 in his checking account. Which financing option should he chose Which of these is NOT a meaning of the root super or sur? Which description matches finding the volume of the solid ? Help me!what is the biggest disadvantage of using nuclear power to produce electricity?a. nuclear fission releases more air pollution than burning coalb. nuclear fission produces less energy than burning coal or oil.c. nuclear waste must be safely stored for many yearsd. nuclear waste must be incinerated The armistice with Germany was signed by 2. Identify these scrambled compound words. Use any resource you like to unscramble these compound words. Hint: each word is scrambled in the same way. (Begin with the end in mind!) Help, please!taoultiopklraanhdsghoehdegrmeibcirfoybluftrtepciantlilnekwkycairtdsrsehtaorophsmtrhoutnsdre